Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R866

Protein Details
Accession F4R866    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
153-179AEIPNLQSHRPNKKANKNPSKKPMNKKHydrophilic
NLS Segment(s)
PositionSequence
162-179RPNKKANKNPSKKPMNKK
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_70810  -  
Amino Acid Sequences MIKEKAKHARENLHTVLLTGIKPDRGCQECTRSIPDLQTLVGLIIQLGKEEIKSKLEGDIWKDTDMLSRTRFAYLRRECLRLYFPDKATSTIWIVVDNQLSYLLSKGRPYTTCFYNLIYQQDRKKFDSGSVMYDDIPIAERSFKLPSDDEVQAEIPNLQSHRPNKKANKNPSKKPMNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.45
3 0.4
4 0.32
5 0.25
6 0.2
7 0.19
8 0.18
9 0.18
10 0.2
11 0.26
12 0.27
13 0.32
14 0.35
15 0.41
16 0.43
17 0.46
18 0.49
19 0.44
20 0.43
21 0.4
22 0.37
23 0.3
24 0.24
25 0.21
26 0.16
27 0.13
28 0.11
29 0.08
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.09
38 0.11
39 0.11
40 0.12
41 0.13
42 0.15
43 0.18
44 0.2
45 0.22
46 0.27
47 0.26
48 0.26
49 0.26
50 0.23
51 0.24
52 0.23
53 0.21
54 0.16
55 0.17
56 0.17
57 0.2
58 0.21
59 0.19
60 0.28
61 0.28
62 0.36
63 0.37
64 0.39
65 0.36
66 0.38
67 0.38
68 0.33
69 0.34
70 0.3
71 0.28
72 0.31
73 0.32
74 0.31
75 0.28
76 0.25
77 0.21
78 0.17
79 0.17
80 0.12
81 0.12
82 0.11
83 0.11
84 0.09
85 0.09
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.09
93 0.1
94 0.13
95 0.15
96 0.19
97 0.22
98 0.23
99 0.26
100 0.26
101 0.27
102 0.27
103 0.28
104 0.29
105 0.3
106 0.33
107 0.36
108 0.42
109 0.45
110 0.44
111 0.44
112 0.39
113 0.37
114 0.4
115 0.35
116 0.31
117 0.3
118 0.28
119 0.25
120 0.25
121 0.22
122 0.13
123 0.14
124 0.11
125 0.09
126 0.09
127 0.1
128 0.12
129 0.14
130 0.15
131 0.17
132 0.17
133 0.2
134 0.24
135 0.25
136 0.24
137 0.24
138 0.24
139 0.2
140 0.2
141 0.17
142 0.13
143 0.14
144 0.14
145 0.15
146 0.22
147 0.3
148 0.4
149 0.47
150 0.56
151 0.63
152 0.73
153 0.81
154 0.85
155 0.88
156 0.88
157 0.91
158 0.91
159 0.92