Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DT85

Protein Details
Accession A0A0C4DT85    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-121RYEKMAEKMHRKRVERLKRREKRNKVLNSBasic
NLS Segment(s)
PositionSequence
22-117GMRKNGKQWHAPRKAFRPGSGLTSYEKRAKDRVAMAAVKAKEKEMKDEKEAEKQQRIQAIKDRRAAKEEKERYEKMAEKMHRKRVERLKRREKRNK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSNNMSNAEVATTNPGQPKPLGMRKNGKQWHAPRKAFRPGSGLTSYEKRAKDRVAMAAVKAKEKEMKDEKEAEKQQRIQAIKDRRAAKEEKERYEKMAEKMHRKRVERLKRREKRNKVLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.22
5 0.27
6 0.3
7 0.38
8 0.39
9 0.43
10 0.52
11 0.56
12 0.66
13 0.66
14 0.62
15 0.63
16 0.67
17 0.71
18 0.72
19 0.72
20 0.69
21 0.7
22 0.76
23 0.69
24 0.61
25 0.55
26 0.46
27 0.45
28 0.39
29 0.33
30 0.26
31 0.27
32 0.28
33 0.29
34 0.29
35 0.26
36 0.28
37 0.28
38 0.29
39 0.28
40 0.28
41 0.27
42 0.26
43 0.24
44 0.26
45 0.26
46 0.23
47 0.21
48 0.18
49 0.19
50 0.19
51 0.26
52 0.27
53 0.3
54 0.31
55 0.39
56 0.4
57 0.44
58 0.5
59 0.48
60 0.47
61 0.47
62 0.47
63 0.46
64 0.46
65 0.4
66 0.42
67 0.46
68 0.47
69 0.5
70 0.52
71 0.48
72 0.51
73 0.51
74 0.5
75 0.52
76 0.53
77 0.54
78 0.57
79 0.57
80 0.55
81 0.6
82 0.58
83 0.52
84 0.53
85 0.52
86 0.55
87 0.63
88 0.7
89 0.7
90 0.69
91 0.74
92 0.76
93 0.8
94 0.8
95 0.82
96 0.83
97 0.85
98 0.92
99 0.93
100 0.93
101 0.93