Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DLZ9

Protein Details
Accession A0A0C4DLZ9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-44QEKAKRPKGRAHKREQYTRRFBasic
NLS Segment(s)
PositionSequence
15-38KSQTPKVEPQEKAKRPKGRAHKRE
55-55R
Subcellular Location(s) nucl 12, cyto 10, mito 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKQHGSLARAGKVKSQTPKVEPQEKAKRPKGRAHKREQYTRRFVNVTLAPGGKRKVRIKFPMGHAACVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.48
4 0.49
5 0.49
6 0.58
7 0.6
8 0.64
9 0.61
10 0.63
11 0.66
12 0.68
13 0.72
14 0.71
15 0.72
16 0.68
17 0.73
18 0.74
19 0.75
20 0.77
21 0.77
22 0.78
23 0.76
24 0.82
25 0.81
26 0.79
27 0.76
28 0.7
29 0.64
30 0.56
31 0.49
32 0.46
33 0.4
34 0.34
35 0.28
36 0.27
37 0.24
38 0.25
39 0.28
40 0.25
41 0.31
42 0.36
43 0.41
44 0.49
45 0.56
46 0.6
47 0.66
48 0.68
49 0.71
50 0.66