Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E0D6

Protein Details
Accession A0A0C4E0D6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-37TAPGGRPSRTDKPNKPNKLNKPSTMPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MGFRIHFRRLTAPGGRPSRTDKPNKPNKLNKPSTMPSAAEIPSTVTRDEHLRMRSRVAADVDDHRNNANNRISGMTRLENIWEAEDFVRQFVLDGWGQYVLDQATIRCDMTLYQLRRVGRMQQTDGVRACRRLVHVPVLCDEVAYQLWTSLAAEEEEGIEEAETEAAGVADRPRRRLEHNGLDKWYTAIMERRAPQPAKHPAAPVYMRCGNCGGLCKSLDGAAESGEEDEGETTPRTLFRCMECSHVLKADVKSTSSDDSEEDGQDEEGYCEPKNYTLSRRISSALRRRSTTRSNRSLTDGEDTSRPRRGSLLPSPKVSIACSLQHAVSTANNTVLAVAENLANFYVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.54
4 0.58
5 0.6
6 0.62
7 0.66
8 0.66
9 0.7
10 0.79
11 0.86
12 0.88
13 0.89
14 0.91
15 0.91
16 0.89
17 0.84
18 0.82
19 0.76
20 0.73
21 0.67
22 0.57
23 0.47
24 0.44
25 0.39
26 0.3
27 0.26
28 0.23
29 0.21
30 0.22
31 0.21
32 0.16
33 0.17
34 0.21
35 0.24
36 0.27
37 0.3
38 0.36
39 0.37
40 0.41
41 0.45
42 0.43
43 0.44
44 0.39
45 0.35
46 0.3
47 0.35
48 0.39
49 0.35
50 0.35
51 0.31
52 0.35
53 0.34
54 0.38
55 0.36
56 0.3
57 0.29
58 0.31
59 0.31
60 0.28
61 0.3
62 0.25
63 0.21
64 0.2
65 0.2
66 0.19
67 0.19
68 0.17
69 0.13
70 0.13
71 0.13
72 0.15
73 0.14
74 0.12
75 0.11
76 0.1
77 0.1
78 0.09
79 0.12
80 0.09
81 0.09
82 0.1
83 0.11
84 0.11
85 0.1
86 0.11
87 0.07
88 0.08
89 0.08
90 0.07
91 0.1
92 0.11
93 0.11
94 0.09
95 0.09
96 0.09
97 0.15
98 0.23
99 0.22
100 0.26
101 0.3
102 0.3
103 0.32
104 0.33
105 0.35
106 0.34
107 0.36
108 0.34
109 0.36
110 0.37
111 0.39
112 0.39
113 0.37
114 0.32
115 0.29
116 0.28
117 0.25
118 0.26
119 0.26
120 0.27
121 0.29
122 0.3
123 0.3
124 0.3
125 0.3
126 0.27
127 0.22
128 0.19
129 0.12
130 0.1
131 0.09
132 0.08
133 0.05
134 0.05
135 0.05
136 0.06
137 0.04
138 0.05
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.02
153 0.02
154 0.02
155 0.03
156 0.05
157 0.11
158 0.12
159 0.14
160 0.17
161 0.19
162 0.23
163 0.31
164 0.37
165 0.42
166 0.49
167 0.5
168 0.5
169 0.48
170 0.44
171 0.36
172 0.29
173 0.19
174 0.12
175 0.13
176 0.13
177 0.17
178 0.19
179 0.2
180 0.26
181 0.27
182 0.27
183 0.32
184 0.38
185 0.39
186 0.39
187 0.38
188 0.34
189 0.39
190 0.39
191 0.32
192 0.29
193 0.3
194 0.28
195 0.27
196 0.27
197 0.22
198 0.21
199 0.25
200 0.2
201 0.18
202 0.18
203 0.17
204 0.16
205 0.16
206 0.16
207 0.12
208 0.1
209 0.07
210 0.07
211 0.07
212 0.07
213 0.06
214 0.05
215 0.05
216 0.05
217 0.05
218 0.06
219 0.06
220 0.06
221 0.07
222 0.1
223 0.11
224 0.13
225 0.15
226 0.16
227 0.22
228 0.22
229 0.27
230 0.29
231 0.3
232 0.3
233 0.29
234 0.28
235 0.27
236 0.27
237 0.27
238 0.24
239 0.22
240 0.22
241 0.23
242 0.23
243 0.2
244 0.19
245 0.15
246 0.17
247 0.18
248 0.17
249 0.15
250 0.13
251 0.13
252 0.12
253 0.11
254 0.1
255 0.1
256 0.11
257 0.1
258 0.11
259 0.11
260 0.14
261 0.17
262 0.2
263 0.25
264 0.32
265 0.38
266 0.38
267 0.4
268 0.4
269 0.42
270 0.49
271 0.53
272 0.54
273 0.53
274 0.55
275 0.57
276 0.62
277 0.67
278 0.68
279 0.68
280 0.68
281 0.67
282 0.66
283 0.67
284 0.62
285 0.54
286 0.49
287 0.4
288 0.33
289 0.34
290 0.36
291 0.35
292 0.39
293 0.37
294 0.32
295 0.34
296 0.36
297 0.39
298 0.45
299 0.52
300 0.5
301 0.54
302 0.55
303 0.54
304 0.51
305 0.43
306 0.38
307 0.3
308 0.28
309 0.28
310 0.28
311 0.25
312 0.25
313 0.24
314 0.21
315 0.2
316 0.21
317 0.18
318 0.17
319 0.17
320 0.16
321 0.16
322 0.15
323 0.13
324 0.09
325 0.09
326 0.09
327 0.09
328 0.1