Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5AH35

Protein Details
Accession Q5AH35   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-26ITSKNKYNKKIENAIKKINKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007741  Ribosome/NADH_DH  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005840  C:ribosome  
KEGG cal:CAALFM_C702120CA  -  
Pfam View protein in Pfam  
PF05047  L51_S25_CI-B8  
Amino Acid Sequences MSTRMFITSKNKYNKKIENAIKKINKLTANPETSFKFDAERFKEIELFVYGQRPITYKPAWGLKLFWKDNLPTLRYHNPDIQFTVNNITVESESELSKLPLKLKVHGTDQSNSFEINCTDKPPSKILSELIEITKARKLTEEELPKLPLRPVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.78
4 0.78
5 0.79
6 0.79
7 0.81
8 0.78
9 0.73
10 0.69
11 0.65
12 0.6
13 0.51
14 0.52
15 0.51
16 0.49
17 0.46
18 0.46
19 0.41
20 0.4
21 0.39
22 0.31
23 0.26
24 0.24
25 0.31
26 0.32
27 0.33
28 0.31
29 0.3
30 0.32
31 0.28
32 0.27
33 0.2
34 0.17
35 0.14
36 0.16
37 0.15
38 0.14
39 0.14
40 0.14
41 0.14
42 0.18
43 0.17
44 0.16
45 0.2
46 0.24
47 0.25
48 0.25
49 0.25
50 0.27
51 0.35
52 0.34
53 0.32
54 0.29
55 0.27
56 0.32
57 0.34
58 0.28
59 0.22
60 0.26
61 0.31
62 0.31
63 0.33
64 0.32
65 0.3
66 0.3
67 0.3
68 0.26
69 0.21
70 0.19
71 0.2
72 0.17
73 0.15
74 0.14
75 0.13
76 0.11
77 0.11
78 0.11
79 0.09
80 0.07
81 0.08
82 0.08
83 0.09
84 0.12
85 0.13
86 0.14
87 0.19
88 0.2
89 0.24
90 0.29
91 0.32
92 0.33
93 0.36
94 0.38
95 0.35
96 0.37
97 0.35
98 0.31
99 0.27
100 0.23
101 0.2
102 0.18
103 0.19
104 0.17
105 0.17
106 0.22
107 0.26
108 0.29
109 0.31
110 0.33
111 0.3
112 0.31
113 0.3
114 0.29
115 0.27
116 0.26
117 0.24
118 0.25
119 0.23
120 0.23
121 0.25
122 0.22
123 0.19
124 0.21
125 0.24
126 0.24
127 0.34
128 0.41
129 0.41
130 0.45
131 0.48
132 0.46
133 0.44