Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EET1

Protein Details
Accession A0A0C4EET1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
212-280KKEAVRKEPAKKEPAKKEPKKKEPLKKEPVKKEPAKKEPAKKAPAKKEAPKKDPAKKPRLHLGRQRGTGBasic
NLS Segment(s)
PositionSequence
165-280PKRAKTEPKGSAKKEAAKKETAKKEPAKKAPAKKETAKKETVRKEPAKKEAVRKEPAKKEPAKKEPKKKEPLKKEPVKKEPAKKEPAKKAPAKKEAPKKDPAKKPRLHLGRQRGTG
Subcellular Location(s) cyto 17, nucl 7.5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MAHAPPVSRDGFSFAADCFSVTTSGGNVHRRRSPAELKDHFASKDDQPAHFYEAQLLHYGLAPSKVKGTAKLRLMEAVMATGAKALAVPAPLAALEKEMKKEWAKACKAAAAAVKAAAATAAPPAAAAGSKKRKAAAESATDVQVVASGGGSVSVSVTVNHGTAPKRAKTEPKGSAKKEAAKKETAKKEPAKKAPAKKETAKKETVRKEPAKKEAVRKEPAKKEPAKKEPKKKEPLKKEPVKKEPAKKEPAKKAPAKKEAPKKDPAKKPRLHLGRQRGTGGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.17
5 0.12
6 0.12
7 0.11
8 0.11
9 0.11
10 0.09
11 0.14
12 0.2
13 0.28
14 0.3
15 0.35
16 0.4
17 0.42
18 0.46
19 0.49
20 0.53
21 0.53
22 0.6
23 0.59
24 0.59
25 0.6
26 0.6
27 0.53
28 0.45
29 0.41
30 0.32
31 0.36
32 0.34
33 0.31
34 0.3
35 0.32
36 0.35
37 0.33
38 0.31
39 0.27
40 0.25
41 0.25
42 0.24
43 0.22
44 0.16
45 0.16
46 0.16
47 0.12
48 0.15
49 0.15
50 0.14
51 0.16
52 0.19
53 0.19
54 0.26
55 0.3
56 0.32
57 0.37
58 0.39
59 0.37
60 0.35
61 0.35
62 0.28
63 0.23
64 0.16
65 0.11
66 0.08
67 0.07
68 0.06
69 0.05
70 0.04
71 0.04
72 0.03
73 0.04
74 0.05
75 0.05
76 0.04
77 0.05
78 0.05
79 0.06
80 0.05
81 0.06
82 0.09
83 0.1
84 0.12
85 0.13
86 0.17
87 0.18
88 0.25
89 0.29
90 0.36
91 0.37
92 0.38
93 0.38
94 0.37
95 0.35
96 0.32
97 0.28
98 0.2
99 0.17
100 0.14
101 0.13
102 0.1
103 0.1
104 0.07
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.12
116 0.19
117 0.22
118 0.23
119 0.25
120 0.26
121 0.28
122 0.33
123 0.3
124 0.26
125 0.27
126 0.27
127 0.25
128 0.24
129 0.22
130 0.16
131 0.12
132 0.07
133 0.05
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.02
140 0.02
141 0.03
142 0.03
143 0.04
144 0.05
145 0.05
146 0.05
147 0.06
148 0.09
149 0.1
150 0.14
151 0.18
152 0.2
153 0.23
154 0.26
155 0.34
156 0.38
157 0.46
158 0.5
159 0.56
160 0.62
161 0.61
162 0.67
163 0.63
164 0.65
165 0.63
166 0.62
167 0.56
168 0.55
169 0.59
170 0.6
171 0.65
172 0.62
173 0.64
174 0.64
175 0.7
176 0.72
177 0.74
178 0.74
179 0.73
180 0.77
181 0.79
182 0.79
183 0.76
184 0.75
185 0.76
186 0.76
187 0.75
188 0.73
189 0.69
190 0.71
191 0.73
192 0.73
193 0.74
194 0.73
195 0.76
196 0.75
197 0.78
198 0.77
199 0.74
200 0.75
201 0.75
202 0.75
203 0.73
204 0.73
205 0.74
206 0.75
207 0.77
208 0.76
209 0.75
210 0.76
211 0.79
212 0.82
213 0.83
214 0.84
215 0.88
216 0.89
217 0.91
218 0.92
219 0.92
220 0.92
221 0.92
222 0.93
223 0.93
224 0.92
225 0.92
226 0.91
227 0.91
228 0.9
229 0.88
230 0.88
231 0.87
232 0.87
233 0.87
234 0.86
235 0.86
236 0.87
237 0.87
238 0.87
239 0.84
240 0.84
241 0.84
242 0.85
243 0.84
244 0.83
245 0.84
246 0.85
247 0.83
248 0.84
249 0.83
250 0.83
251 0.85
252 0.86
253 0.85
254 0.81
255 0.82
256 0.83
257 0.83
258 0.82
259 0.82
260 0.82
261 0.81
262 0.79