Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E9J2

Protein Details
Accession A0A0C4E9J2   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-36SDRLTRNLSRRPARPRRPHQGARYVLHydrophilic
NLS Segment(s)
PositionSequence
20-27RRPARPRR
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MTAQCSRGRSSDRLTRNLSRRPARPRRPHQGARYVLIDTPGFDDMNRLNSEITESILTWWVQASFKNAVLATTFWEQVPAAVAEVGEEELRETNDFWGPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.63
4 0.67
5 0.69
6 0.67
7 0.68
8 0.73
9 0.77
10 0.79
11 0.82
12 0.84
13 0.85
14 0.87
15 0.88
16 0.85
17 0.83
18 0.76
19 0.68
20 0.6
21 0.5
22 0.41
23 0.34
24 0.26
25 0.17
26 0.15
27 0.13
28 0.11
29 0.09
30 0.1
31 0.09
32 0.13
33 0.13
34 0.11
35 0.1
36 0.1
37 0.12
38 0.1
39 0.11
40 0.07
41 0.07
42 0.07
43 0.09
44 0.09
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.12
51 0.12
52 0.13
53 0.15
54 0.14
55 0.14
56 0.14
57 0.14
58 0.14
59 0.14
60 0.14
61 0.12
62 0.13
63 0.12
64 0.11
65 0.13
66 0.1
67 0.08
68 0.08
69 0.08
70 0.07
71 0.08
72 0.08
73 0.06
74 0.06
75 0.06
76 0.07
77 0.09
78 0.1
79 0.1
80 0.12