Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E7M9

Protein Details
Accession A0A0C4E7M9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-50KWYCKECKKRLGIPDKKSNAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12cyto 12cyto_mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
Amino Acid Sequences MIGCDANEACPYEWFHLDCVGLKAAPKTNVKWYCKECKKRLGIPDKKSNATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.18
5 0.17
6 0.16
7 0.14
8 0.12
9 0.12
10 0.13
11 0.14
12 0.18
13 0.19
14 0.2
15 0.29
16 0.37
17 0.39
18 0.44
19 0.47
20 0.53
21 0.62
22 0.7
23 0.67
24 0.69
25 0.74
26 0.74
27 0.79
28 0.79
29 0.79
30 0.78
31 0.82
32 0.79