Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EGT6

Protein Details
Accession A0A0C4EGT6    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-51TTKLPAKTTSQKTRRARTRDTQQLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038089  Med31_sf  
IPR008831  Mediator_Med31  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05669  Med31  
Amino Acid Sequences MWGSGARAKGKAPTMARQQRDSTSIFTTKLPAKTTSQKTRRARTRDTQQLQQTTMSTVPTEPPAPPASSTSKTDEAGEVKYGGYTRFELELEFVQSLGNPVYLNHLAAQKLLSQPAFVAYLAYLQYWTRPPYVKYLTYPGPTLRNLELLQQERFRQDIISPDLVQGMIQGGMRAAVEWHKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.6
4 0.6
5 0.59
6 0.55
7 0.55
8 0.49
9 0.42
10 0.38
11 0.36
12 0.32
13 0.29
14 0.3
15 0.32
16 0.34
17 0.33
18 0.3
19 0.34
20 0.42
21 0.51
22 0.57
23 0.59
24 0.65
25 0.71
26 0.78
27 0.82
28 0.8
29 0.78
30 0.77
31 0.8
32 0.81
33 0.77
34 0.75
35 0.73
36 0.69
37 0.62
38 0.54
39 0.44
40 0.34
41 0.3
42 0.22
43 0.15
44 0.12
45 0.12
46 0.12
47 0.13
48 0.11
49 0.13
50 0.15
51 0.15
52 0.15
53 0.18
54 0.21
55 0.23
56 0.25
57 0.27
58 0.27
59 0.27
60 0.26
61 0.25
62 0.21
63 0.19
64 0.17
65 0.13
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.08
72 0.08
73 0.09
74 0.09
75 0.08
76 0.09
77 0.09
78 0.09
79 0.08
80 0.08
81 0.06
82 0.06
83 0.07
84 0.06
85 0.06
86 0.04
87 0.04
88 0.09
89 0.09
90 0.09
91 0.1
92 0.12
93 0.12
94 0.12
95 0.13
96 0.11
97 0.12
98 0.13
99 0.11
100 0.09
101 0.09
102 0.1
103 0.11
104 0.08
105 0.08
106 0.06
107 0.07
108 0.08
109 0.08
110 0.07
111 0.06
112 0.09
113 0.11
114 0.13
115 0.15
116 0.18
117 0.19
118 0.26
119 0.32
120 0.32
121 0.32
122 0.36
123 0.38
124 0.38
125 0.39
126 0.34
127 0.32
128 0.31
129 0.31
130 0.27
131 0.26
132 0.24
133 0.27
134 0.31
135 0.3
136 0.33
137 0.33
138 0.34
139 0.32
140 0.33
141 0.29
142 0.23
143 0.21
144 0.24
145 0.26
146 0.29
147 0.27
148 0.27
149 0.27
150 0.26
151 0.24
152 0.17
153 0.12
154 0.09
155 0.08
156 0.08
157 0.07
158 0.08
159 0.08
160 0.08
161 0.08
162 0.14