Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E8Y6

Protein Details
Accession A0A0C4E8Y6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
106-126AQRSVPCTSRPPRKDNKGMRHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 8, cyto 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MLFCLAGYALQTQTWPACYTAVVGKDDTSTRRVLPNRLTISLRSAKAPKGLTPPAYNTSAVAAAGSQVRDESGRLALVCIVFRYAPFVRPCWEGCLHIRLPTAAGAQRSVPCTSRPPRKDNKGMRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.12
5 0.12
6 0.14
7 0.17
8 0.19
9 0.18
10 0.17
11 0.17
12 0.18
13 0.21
14 0.21
15 0.19
16 0.18
17 0.18
18 0.25
19 0.27
20 0.31
21 0.35
22 0.41
23 0.43
24 0.44
25 0.44
26 0.38
27 0.41
28 0.41
29 0.36
30 0.3
31 0.29
32 0.27
33 0.3
34 0.31
35 0.27
36 0.28
37 0.3
38 0.3
39 0.29
40 0.31
41 0.29
42 0.3
43 0.27
44 0.21
45 0.18
46 0.16
47 0.13
48 0.1
49 0.06
50 0.05
51 0.06
52 0.05
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.08
65 0.08
66 0.07
67 0.07
68 0.07
69 0.06
70 0.12
71 0.12
72 0.17
73 0.18
74 0.2
75 0.22
76 0.25
77 0.26
78 0.26
79 0.27
80 0.24
81 0.26
82 0.31
83 0.29
84 0.3
85 0.29
86 0.24
87 0.24
88 0.22
89 0.22
90 0.18
91 0.19
92 0.17
93 0.19
94 0.21
95 0.23
96 0.24
97 0.23
98 0.23
99 0.31
100 0.39
101 0.47
102 0.51
103 0.57
104 0.66
105 0.74
106 0.82