Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4ECG4

Protein Details
Accession A0A0C4ECG4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-102QAKPAQPERKKVRREHTGRMDGPBasic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MNHHKGKQTLSSAPCFLSGAWLGIEAANEKDSDGRLSHDPVGRMGDWCPGFNGQRRRFIVCTASAGPSLAGIHDDSPSIQAKPAQPERKKVRREHTGRMDGPLALCPSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.26
4 0.22
5 0.17
6 0.13
7 0.12
8 0.11
9 0.11
10 0.1
11 0.11
12 0.08
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.1
20 0.1
21 0.12
22 0.13
23 0.16
24 0.2
25 0.22
26 0.22
27 0.21
28 0.23
29 0.2
30 0.19
31 0.17
32 0.18
33 0.16
34 0.16
35 0.16
36 0.15
37 0.16
38 0.22
39 0.32
40 0.3
41 0.37
42 0.39
43 0.42
44 0.4
45 0.4
46 0.37
47 0.28
48 0.28
49 0.22
50 0.21
51 0.17
52 0.16
53 0.14
54 0.12
55 0.11
56 0.07
57 0.06
58 0.05
59 0.06
60 0.06
61 0.06
62 0.06
63 0.09
64 0.1
65 0.1
66 0.1
67 0.14
68 0.17
69 0.25
70 0.35
71 0.43
72 0.45
73 0.55
74 0.65
75 0.7
76 0.76
77 0.76
78 0.76
79 0.77
80 0.8
81 0.81
82 0.81
83 0.81
84 0.74
85 0.7
86 0.62
87 0.52
88 0.46
89 0.39
90 0.31