Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E5G3

Protein Details
Accession A0A0C4E5G3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-66QQSRGFKKRAFKPKVQGVVIHydrophilic
243-267YTVQITFLKRRHKKRSANNDDDNSAHydrophilic
NLS Segment(s)
PositionSequence
88-89RG
253-256RHKK
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MLCPRALSAAPRPCLVRQIYAAKCRPPADYSAWRPPAACLQTAPIQQQSRGFKKRAFKPKVQGVVITTETGEAERAGARVYGPKGGARGRGQDKRTKGETALRDKQLLEYPLIHLKNRDSSTLSEPLATDDVLADVDLETDTLLCVYLPSPKAEADADAAAEAEDEMDDEEAAAPREAASKRPQIPICVVMNRAKYEEHLENERREQRIRELGTKEMEINWTIDQHDLGHKLRRLREFLGKGYTVQITFLKRRHKKRSANNDDDNSAAAETVRLVKEAAAEVPGAKECKRPEGSMGRTLTLTFDAPGVKNWKLAAAAEAAADPDSSPADSGSSTSAEPSSSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.38
4 0.35
5 0.43
6 0.48
7 0.54
8 0.58
9 0.56
10 0.59
11 0.56
12 0.53
13 0.46
14 0.45
15 0.44
16 0.48
17 0.51
18 0.56
19 0.58
20 0.55
21 0.53
22 0.5
23 0.5
24 0.43
25 0.37
26 0.27
27 0.27
28 0.33
29 0.35
30 0.36
31 0.34
32 0.34
33 0.34
34 0.4
35 0.45
36 0.49
37 0.53
38 0.54
39 0.52
40 0.6
41 0.68
42 0.72
43 0.71
44 0.7
45 0.72
46 0.78
47 0.81
48 0.73
49 0.65
50 0.56
51 0.53
52 0.45
53 0.36
54 0.26
55 0.18
56 0.17
57 0.14
58 0.13
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.13
67 0.14
68 0.16
69 0.16
70 0.17
71 0.2
72 0.23
73 0.28
74 0.25
75 0.33
76 0.38
77 0.45
78 0.48
79 0.52
80 0.54
81 0.55
82 0.56
83 0.5
84 0.45
85 0.45
86 0.49
87 0.51
88 0.54
89 0.5
90 0.48
91 0.46
92 0.45
93 0.42
94 0.35
95 0.27
96 0.2
97 0.2
98 0.26
99 0.27
100 0.25
101 0.22
102 0.23
103 0.29
104 0.29
105 0.28
106 0.23
107 0.25
108 0.29
109 0.32
110 0.3
111 0.23
112 0.22
113 0.21
114 0.2
115 0.16
116 0.11
117 0.07
118 0.07
119 0.06
120 0.06
121 0.04
122 0.03
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.02
132 0.03
133 0.03
134 0.08
135 0.09
136 0.1
137 0.11
138 0.11
139 0.13
140 0.13
141 0.13
142 0.1
143 0.09
144 0.08
145 0.07
146 0.07
147 0.06
148 0.05
149 0.04
150 0.03
151 0.02
152 0.02
153 0.03
154 0.03
155 0.02
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.09
164 0.09
165 0.12
166 0.16
167 0.23
168 0.26
169 0.33
170 0.33
171 0.31
172 0.32
173 0.35
174 0.33
175 0.27
176 0.27
177 0.25
178 0.26
179 0.25
180 0.24
181 0.2
182 0.18
183 0.21
184 0.22
185 0.21
186 0.26
187 0.29
188 0.3
189 0.36
190 0.4
191 0.37
192 0.36
193 0.35
194 0.33
195 0.38
196 0.38
197 0.38
198 0.36
199 0.37
200 0.37
201 0.36
202 0.31
203 0.24
204 0.22
205 0.16
206 0.15
207 0.12
208 0.11
209 0.11
210 0.11
211 0.1
212 0.1
213 0.12
214 0.14
215 0.16
216 0.22
217 0.24
218 0.29
219 0.35
220 0.39
221 0.4
222 0.4
223 0.48
224 0.45
225 0.46
226 0.45
227 0.4
228 0.36
229 0.34
230 0.32
231 0.22
232 0.2
233 0.2
234 0.2
235 0.24
236 0.29
237 0.38
238 0.45
239 0.55
240 0.64
241 0.71
242 0.76
243 0.82
244 0.88
245 0.88
246 0.89
247 0.88
248 0.81
249 0.72
250 0.63
251 0.52
252 0.42
253 0.31
254 0.21
255 0.12
256 0.08
257 0.07
258 0.11
259 0.11
260 0.1
261 0.1
262 0.11
263 0.12
264 0.13
265 0.13
266 0.1
267 0.1
268 0.1
269 0.11
270 0.13
271 0.14
272 0.14
273 0.19
274 0.2
275 0.29
276 0.32
277 0.32
278 0.37
279 0.45
280 0.49
281 0.52
282 0.52
283 0.44
284 0.41
285 0.4
286 0.34
287 0.26
288 0.21
289 0.13
290 0.13
291 0.14
292 0.15
293 0.2
294 0.23
295 0.22
296 0.24
297 0.24
298 0.24
299 0.22
300 0.22
301 0.19
302 0.16
303 0.15
304 0.14
305 0.14
306 0.12
307 0.11
308 0.11
309 0.09
310 0.08
311 0.08
312 0.08
313 0.08
314 0.08
315 0.09
316 0.09
317 0.1
318 0.11
319 0.12
320 0.12
321 0.13
322 0.13
323 0.13