Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DQK5

Protein Details
Accession A0A0C4DQK5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
88-117GHARRCNREAKAKKKKKKKTGEQKIPLLPSBasic
NLS Segment(s)
PositionSequence
95-108REAKAKKKKKKKTG
Subcellular Location(s) mito 11, nucl 10, extr 4
Family & Domain DBs
Amino Acid Sequences MKDLGASVSQLWLLDEPFVGLASAVPLWSIMQRSQQGEKQQGWARVAWQAWRKRSRLSVSGRPLNCPGSVNKASHPGLTPGTDLWLGGHARRCNREAKAKKKKKKKTGEQKIPLLPSNGPPSMKQAQILPYRVSEDHLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.08
6 0.07
7 0.06
8 0.05
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.07
16 0.09
17 0.09
18 0.15
19 0.19
20 0.23
21 0.27
22 0.31
23 0.36
24 0.39
25 0.39
26 0.41
27 0.42
28 0.43
29 0.4
30 0.36
31 0.31
32 0.29
33 0.29
34 0.27
35 0.3
36 0.32
37 0.39
38 0.45
39 0.45
40 0.45
41 0.51
42 0.5
43 0.5
44 0.51
45 0.52
46 0.53
47 0.59
48 0.56
49 0.52
50 0.49
51 0.42
52 0.35
53 0.28
54 0.21
55 0.21
56 0.23
57 0.22
58 0.2
59 0.25
60 0.25
61 0.24
62 0.24
63 0.18
64 0.17
65 0.17
66 0.16
67 0.1
68 0.11
69 0.1
70 0.09
71 0.07
72 0.09
73 0.09
74 0.11
75 0.16
76 0.18
77 0.22
78 0.26
79 0.28
80 0.3
81 0.35
82 0.44
83 0.48
84 0.56
85 0.64
86 0.72
87 0.8
88 0.85
89 0.91
90 0.91
91 0.92
92 0.92
93 0.92
94 0.93
95 0.94
96 0.92
97 0.9
98 0.86
99 0.79
100 0.7
101 0.62
102 0.51
103 0.45
104 0.43
105 0.37
106 0.32
107 0.29
108 0.33
109 0.35
110 0.35
111 0.31
112 0.28
113 0.33
114 0.39
115 0.42
116 0.37
117 0.34
118 0.37
119 0.36