Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E7Z0

Protein Details
Accession A0A0C4E7Z0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKGDQGRERKKTKKTKENKDSVDEGBasic
NLS Segment(s)
PositionSequence
7-16RERKKTKKTK
Subcellular Location(s) nucl 11, cyto_nucl 10, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Amino Acid Sequences MKGDQGRERKKTKKTKENKDSVDEGKNDAAAAAAAPEEQADADAGAPDRTFHRYYHLYRKGELEEDVAAAGGVVLDSGYERDNWWAIAARSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.91
4 0.92
5 0.88
6 0.83
7 0.78
8 0.71
9 0.67
10 0.57
11 0.48
12 0.39
13 0.33
14 0.26
15 0.2
16 0.15
17 0.08
18 0.07
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.06
36 0.1
37 0.11
38 0.11
39 0.16
40 0.22
41 0.27
42 0.37
43 0.45
44 0.42
45 0.42
46 0.46
47 0.42
48 0.38
49 0.34
50 0.25
51 0.17
52 0.15
53 0.14
54 0.1
55 0.08
56 0.06
57 0.05
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.04
65 0.05
66 0.05
67 0.06
68 0.09
69 0.11
70 0.11
71 0.13
72 0.16
73 0.16