Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E187

Protein Details
Accession A0A0C4E187    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPERKRGGRRGRPKKPAGPSQMPABasic
NLS Segment(s)
PositionSequence
4-18RKRGGRRGRPKKPAG
Subcellular Location(s) mito 13, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001370  BIR_rpt  
Pfam View protein in Pfam  
PF00653  BIR  
PROSITE View protein in PROSITE  
PS50143  BIR_REPEAT_2  
CDD cd00022  BIR  
Amino Acid Sequences MPERKRGGRRGRPKKPAGPSQMPAGATKQGPCPDKLAVAKSLMLSIGDYNALSARLKSFEKIQWPHARPTPKDLAAAGFFYDPYGVTTGLPAEMARRPVATSVWSYDDQGRPDPMDNCICPSCEINVDGWEADDDPFEEHTKRSPRCRMAHALKRQRGATDAAAAPAPAPAADDQAQDPAEHRRKRRSVLLLDGSELSKGDEQRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.88
4 0.86
5 0.83
6 0.75
7 0.71
8 0.66
9 0.57
10 0.49
11 0.42
12 0.36
13 0.29
14 0.29
15 0.28
16 0.3
17 0.32
18 0.32
19 0.33
20 0.3
21 0.34
22 0.35
23 0.32
24 0.29
25 0.28
26 0.27
27 0.24
28 0.23
29 0.18
30 0.14
31 0.11
32 0.09
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.07
40 0.08
41 0.08
42 0.11
43 0.12
44 0.13
45 0.17
46 0.2
47 0.29
48 0.31
49 0.39
50 0.46
51 0.48
52 0.52
53 0.53
54 0.57
55 0.49
56 0.53
57 0.52
58 0.43
59 0.41
60 0.36
61 0.32
62 0.26
63 0.25
64 0.19
65 0.12
66 0.1
67 0.09
68 0.08
69 0.06
70 0.06
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.07
81 0.09
82 0.09
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.09
89 0.1
90 0.13
91 0.13
92 0.14
93 0.17
94 0.18
95 0.18
96 0.19
97 0.18
98 0.15
99 0.17
100 0.17
101 0.16
102 0.17
103 0.16
104 0.18
105 0.18
106 0.17
107 0.16
108 0.17
109 0.14
110 0.13
111 0.13
112 0.11
113 0.12
114 0.12
115 0.1
116 0.09
117 0.09
118 0.08
119 0.07
120 0.07
121 0.06
122 0.06
123 0.08
124 0.09
125 0.1
126 0.1
127 0.16
128 0.25
129 0.29
130 0.36
131 0.44
132 0.51
133 0.55
134 0.61
135 0.64
136 0.66
137 0.71
138 0.74
139 0.76
140 0.73
141 0.73
142 0.68
143 0.59
144 0.51
145 0.45
146 0.35
147 0.3
148 0.25
149 0.22
150 0.2
151 0.19
152 0.17
153 0.13
154 0.11
155 0.06
156 0.07
157 0.06
158 0.1
159 0.11
160 0.13
161 0.13
162 0.16
163 0.17
164 0.15
165 0.17
166 0.23
167 0.32
168 0.37
169 0.43
170 0.51
171 0.57
172 0.63
173 0.71
174 0.7
175 0.68
176 0.71
177 0.73
178 0.64
179 0.59
180 0.55
181 0.46
182 0.37
183 0.3
184 0.22
185 0.18
186 0.18