Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EDA7

Protein Details
Accession A0A0C4EDA7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
50-71GLNHLPKLPKPKPRPNPTFPAPHydrophilic
157-177LNALPKRPTPKPRPNPTFPPPHydrophilic
NLS Segment(s)
PositionSequence
55-96PKLPKPKPRPNPTFPAPPPGGDRPVRNPNGRSVRTRPGRGRR
162-170KRPTPKPRP
Subcellular Location(s) extr 19, mito 3, plas 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MRFSLLFHLGAMAALAAPVLAQNAATSDSAALAAGGMEEAAVLEARRDPGLNHLPKLPKPKPRPNPTFPAPPPGGDRPVRNPNGRSVRTRPGRGRRSLQEEVPVLEARRDPGLNHLPKRPKAAILRGLHPGFGNNGRRSLQEDEEVAVLEARRDPGLNALPKRPTPKPRPNPTFPPPPPGGNRPVRNPNANRTQPASAISQCMAMSCSVVEVHNENEYKVTILSIGELSNEVVSDAQKSSSTMSDGTKTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.04
7 0.03
8 0.04
9 0.04
10 0.05
11 0.07
12 0.08
13 0.08
14 0.07
15 0.08
16 0.08
17 0.08
18 0.06
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.03
28 0.03
29 0.03
30 0.04
31 0.06
32 0.08
33 0.09
34 0.09
35 0.09
36 0.17
37 0.27
38 0.31
39 0.31
40 0.36
41 0.41
42 0.45
43 0.55
44 0.54
45 0.54
46 0.6
47 0.69
48 0.74
49 0.8
50 0.84
51 0.8
52 0.82
53 0.77
54 0.78
55 0.68
56 0.66
57 0.56
58 0.49
59 0.47
60 0.42
61 0.42
62 0.35
63 0.37
64 0.35
65 0.44
66 0.48
67 0.47
68 0.45
69 0.48
70 0.55
71 0.55
72 0.54
73 0.5
74 0.54
75 0.57
76 0.63
77 0.62
78 0.63
79 0.68
80 0.68
81 0.69
82 0.65
83 0.67
84 0.63
85 0.55
86 0.5
87 0.43
88 0.38
89 0.33
90 0.28
91 0.19
92 0.17
93 0.16
94 0.12
95 0.13
96 0.12
97 0.1
98 0.18
99 0.27
100 0.32
101 0.35
102 0.41
103 0.45
104 0.47
105 0.53
106 0.45
107 0.41
108 0.39
109 0.42
110 0.43
111 0.39
112 0.4
113 0.4
114 0.39
115 0.33
116 0.29
117 0.24
118 0.17
119 0.2
120 0.24
121 0.19
122 0.22
123 0.22
124 0.23
125 0.26
126 0.28
127 0.24
128 0.19
129 0.19
130 0.17
131 0.17
132 0.16
133 0.12
134 0.09
135 0.07
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.1
143 0.16
144 0.22
145 0.23
146 0.27
147 0.3
148 0.33
149 0.38
150 0.41
151 0.46
152 0.5
153 0.59
154 0.65
155 0.73
156 0.79
157 0.8
158 0.82
159 0.79
160 0.8
161 0.7
162 0.67
163 0.58
164 0.55
165 0.53
166 0.49
167 0.5
168 0.48
169 0.51
170 0.51
171 0.58
172 0.58
173 0.62
174 0.61
175 0.61
176 0.63
177 0.63
178 0.59
179 0.53
180 0.5
181 0.43
182 0.41
183 0.37
184 0.27
185 0.26
186 0.23
187 0.2
188 0.18
189 0.17
190 0.15
191 0.11
192 0.1
193 0.08
194 0.08
195 0.07
196 0.08
197 0.09
198 0.1
199 0.12
200 0.18
201 0.18
202 0.17
203 0.18
204 0.18
205 0.17
206 0.16
207 0.14
208 0.09
209 0.09
210 0.1
211 0.09
212 0.09
213 0.09
214 0.09
215 0.1
216 0.09
217 0.09
218 0.08
219 0.07
220 0.08
221 0.1
222 0.1
223 0.11
224 0.11
225 0.12
226 0.14
227 0.16
228 0.17
229 0.18
230 0.2