Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DSF3

Protein Details
Accession A0A0C4DSF3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MNHRRKGSTACHRPNRPGAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MNHRRKGSTACHRPNRPGAPSGRGRLVPALDDGTAPSAGLAVYENEPDVHPGLLADERCVLVPHMGTHTVETQAKMEELALANVAAAVQRGTLLTIVPEQRGLDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.71
4 0.66
5 0.6
6 0.58
7 0.58
8 0.55
9 0.5
10 0.43
11 0.4
12 0.36
13 0.32
14 0.26
15 0.21
16 0.18
17 0.14
18 0.13
19 0.12
20 0.11
21 0.1
22 0.09
23 0.07
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.07
34 0.08
35 0.08
36 0.06
37 0.06
38 0.05
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.09
52 0.1
53 0.1
54 0.11
55 0.12
56 0.14
57 0.15
58 0.14
59 0.13
60 0.13
61 0.13
62 0.12
63 0.1
64 0.1
65 0.09
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.04
73 0.04
74 0.04
75 0.03
76 0.04
77 0.04
78 0.05
79 0.06
80 0.06
81 0.07
82 0.12
83 0.14
84 0.15
85 0.16