Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RDU5

Protein Details
Accession F4RDU5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
11-33SISTTVSKKKKTHPKNVTQSQDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_95943  -  
Amino Acid Sequences MKGTSDADSNSISTTVSKKKKTHPKNVTQSQDVPTVVDVDQDSSGEDEKESRPGKKADVMELLEYFGVPKHKGNKVGVPMFFTTLLSNFYCNHSLFNFLISSFGYTSIFLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.25
3 0.32
4 0.39
5 0.44
6 0.54
7 0.65
8 0.73
9 0.79
10 0.8
11 0.82
12 0.86
13 0.9
14 0.86
15 0.8
16 0.74
17 0.65
18 0.58
19 0.47
20 0.37
21 0.27
22 0.23
23 0.18
24 0.15
25 0.12
26 0.09
27 0.09
28 0.09
29 0.09
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.08
36 0.15
37 0.17
38 0.17
39 0.2
40 0.21
41 0.23
42 0.26
43 0.27
44 0.22
45 0.25
46 0.24
47 0.22
48 0.21
49 0.2
50 0.14
51 0.13
52 0.1
53 0.07
54 0.08
55 0.08
56 0.11
57 0.18
58 0.22
59 0.27
60 0.3
61 0.34
62 0.39
63 0.44
64 0.41
65 0.38
66 0.35
67 0.31
68 0.29
69 0.24
70 0.17
71 0.13
72 0.15
73 0.12
74 0.13
75 0.12
76 0.16
77 0.18
78 0.18
79 0.19
80 0.17
81 0.21
82 0.2
83 0.21
84 0.18
85 0.15
86 0.16
87 0.14
88 0.16
89 0.12
90 0.13
91 0.11
92 0.11