FuNGI

A0A0C4E0E4

Protein Details

Accession

A0A0C4E0E4

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
44-64	EDNLKREIKKLQRLRDQIKTW	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR038635 CCR4-NOT_su2/3/5_C_sf IPR012270 CCR4-NOT_su3/5 IPR040168 Not2/3/5 IPR007282 NOT2/3/5_C IPR007207 Not_N
Gene Ontology	GO:0030015 C:CCR4-NOT core complex GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0000290 P:deadenylation-dependent decapping of nuclear-transcribed mRNA GO:0031087 P:deadenylation-independent decapping of nuclear-transcribed mRNA GO:0000289 P:nuclear-transcribed mRNA poly(A) tail shortening GO:0032968 P:positive regulation of transcription elongation by RNA polymerase II GO:0016567 P:protein ubiquitination GO:0006368 P:transcription elongation by RNA polymerase II
Pfam	View protein in Pfam PF04153 NOT2_3_5 PF04065 Not3

Amino Acid Sequences

MAARKLQQEVDKCFKKVSEGVTEFEAIYEKIEQSTNPAQKEKLEDNLKREIKKLQRLRDQIKTWAASNDIKDKAPLLENRRKIETQMEKFKAVEKAMKTKAYSKEGLSAAAKLDPKEQAKAEASEFLGSTIDALELQIEALEAEAEQIQATVKKGKVTGAKAERMARIEEIIERHKWHQGKLELIRRSLENGGVETDQVTELEESIKYYVSDGMQDDFMEDDTLYDDLALGEEEDAYGMSQDNDKNSSQDNQSVQEESTEDTRPTPSAAAAKPRTAAEASNAGQRRPSTQMKSPLPTLATLHTPLPTISNVPSSTSAAAQAAAAAQKAQEEAEEESIYHLPASLQDLVESFEMTKKRAAPVNSAATLRAIAQSQSCQPGTNDSDPLPAYHPEMRVHSSSAYPRHPLPIFADVRLYNRLDTDTLFYIFYYKQGTYQQFLAAKALKEQSWRFHKQYQTWFQRHEEPKNITEEFEQGTYRFFDYESTWMNRRKADFKFAYKYLEDDI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.51
2	0.49
3	0.46
4	0.44
5	0.44
6	0.4
7	0.41
8	0.41
9	0.41
10	0.35
11	0.31
12	0.26
13	0.16
14	0.15
15	0.15
16	0.13
17	0.13
18	0.15
19	0.14
20	0.2
21	0.3
22	0.34
23	0.36
24	0.39
25	0.39
26	0.41
27	0.48
28	0.45
29	0.44
30	0.48
31	0.49
32	0.51
33	0.6
34	0.63
35	0.58
36	0.57
37	0.57
38	0.56
39	0.62
40	0.66
41	0.66
42	0.7
43	0.77
44	0.82
45	0.82
46	0.77
47	0.74
48	0.72
49	0.64
50	0.56
51	0.49
52	0.46
53	0.4
54	0.4
55	0.4
56	0.35
57	0.33
58	0.32
59	0.31
60	0.3
61	0.32
62	0.35
63	0.36
64	0.43
65	0.5
66	0.53
67	0.58
68	0.55
69	0.51
70	0.54
71	0.55
72	0.55
73	0.58
74	0.58
75	0.54
76	0.54
77	0.57
78	0.52
79	0.44
80	0.41
81	0.35
82	0.41
83	0.44
84	0.48
85	0.45
86	0.48
87	0.53
88	0.52
89	0.5
90	0.43
91	0.44
92	0.4
93	0.42
94	0.35
95	0.28
96	0.23
97	0.25
98	0.25
99	0.19
100	0.21
101	0.24
102	0.25
103	0.28
104	0.27
105	0.28
106	0.29
107	0.31
108	0.29
109	0.26
110	0.25
111	0.22
112	0.21
113	0.16
114	0.13
115	0.11
116	0.1
117	0.06
118	0.06
119	0.05
120	0.05
121	0.04
122	0.04
123	0.04
124	0.04
125	0.03
126	0.03
127	0.03
128	0.03
129	0.03
130	0.04
131	0.04
132	0.04
133	0.04
134	0.04
135	0.05
136	0.07
137	0.08
138	0.13
139	0.14
140	0.16
141	0.17
142	0.21
143	0.27
144	0.29
145	0.37
146	0.38
147	0.41
148	0.43
149	0.46
150	0.43
151	0.39
152	0.37
153	0.28
154	0.23
155	0.2
156	0.18
157	0.18
158	0.19
159	0.19
160	0.2
161	0.22
162	0.27
163	0.28
164	0.28
165	0.32
166	0.32
167	0.38
168	0.43
169	0.5
170	0.47
171	0.46
172	0.46
173	0.38
174	0.38
175	0.31
176	0.25
177	0.17
178	0.14
179	0.15
180	0.13
181	0.13
182	0.1
183	0.1
184	0.08
185	0.07
186	0.07
187	0.05
188	0.05
189	0.06
190	0.06
191	0.06
192	0.06
193	0.07
194	0.06
195	0.07
196	0.08
197	0.07
198	0.09
199	0.09
200	0.09
201	0.09
202	0.09
203	0.09
204	0.07
205	0.07
206	0.06
207	0.05
208	0.05
209	0.05
210	0.05
211	0.05
212	0.04
213	0.04
214	0.04
215	0.04
216	0.04
217	0.03
218	0.03
219	0.03
220	0.03
221	0.03
222	0.03
223	0.03
224	0.03
225	0.03
226	0.03
227	0.06
228	0.07
229	0.08
230	0.1
231	0.11
232	0.12
233	0.13
234	0.16
235	0.15
236	0.18
237	0.19
238	0.19
239	0.19
240	0.19
241	0.18
242	0.15
243	0.15
244	0.11
245	0.12
246	0.11
247	0.1
248	0.1
249	0.11
250	0.1
251	0.11
252	0.1
253	0.09
254	0.13
255	0.14
256	0.21
257	0.22
258	0.23
259	0.24
260	0.23
261	0.24
262	0.2
263	0.19
264	0.12
265	0.16
266	0.16
267	0.21
268	0.22
269	0.2
270	0.21
271	0.21
272	0.22
273	0.23
274	0.29
275	0.27
276	0.32
277	0.42
278	0.44
279	0.46
280	0.44
281	0.4
282	0.35
283	0.31
284	0.26
285	0.19
286	0.17
287	0.15
288	0.15
289	0.13
290	0.13
291	0.12
292	0.12
293	0.11
294	0.11
295	0.1
296	0.13
297	0.13
298	0.14
299	0.15
300	0.15
301	0.15
302	0.14
303	0.13
304	0.1
305	0.1
306	0.08
307	0.07
308	0.06
309	0.06
310	0.06
311	0.05
312	0.05
313	0.05
314	0.05
315	0.05
316	0.05
317	0.06
318	0.08
319	0.1
320	0.1
321	0.1
322	0.12
323	0.12
324	0.12
325	0.1
326	0.08
327	0.06
328	0.07
329	0.1
330	0.1
331	0.1
332	0.1
333	0.1
334	0.12
335	0.12
336	0.11
337	0.08
338	0.11
339	0.12
340	0.13
341	0.16
342	0.16
343	0.2
344	0.25
345	0.26
346	0.28
347	0.34
348	0.39
349	0.38
350	0.37
351	0.34
352	0.29
353	0.27
354	0.22
355	0.16
356	0.11
357	0.09
358	0.1
359	0.12
360	0.15
361	0.19
362	0.19
363	0.19
364	0.18
365	0.24
366	0.28
367	0.29
368	0.29
369	0.24
370	0.27
371	0.26
372	0.27
373	0.24
374	0.19
375	0.2
376	0.22
377	0.24
378	0.23
379	0.26
380	0.29
381	0.28
382	0.28
383	0.25
384	0.25
385	0.29
386	0.33
387	0.33
388	0.32
389	0.32
390	0.37
391	0.36
392	0.35
393	0.33
394	0.36
395	0.34
396	0.32
397	0.35
398	0.29
399	0.32
400	0.34
401	0.31
402	0.22
403	0.21
404	0.23
405	0.19
406	0.19
407	0.2
408	0.18
409	0.18
410	0.18
411	0.16
412	0.17
413	0.17
414	0.17
415	0.17
416	0.15
417	0.17
418	0.24
419	0.28
420	0.28
421	0.29
422	0.33
423	0.32
424	0.33
425	0.34
426	0.31
427	0.28
428	0.3
429	0.32
430	0.28
431	0.32
432	0.35
433	0.39
434	0.45
435	0.52
436	0.52
437	0.56
438	0.63
439	0.65
440	0.72
441	0.73
442	0.75
443	0.74
444	0.73
445	0.7
446	0.73
447	0.72
448	0.7
449	0.69
450	0.64
451	0.61
452	0.63
453	0.59
454	0.51
455	0.44
456	0.39
457	0.32
458	0.28
459	0.25
460	0.19
461	0.2
462	0.21
463	0.2
464	0.17
465	0.15
466	0.15
467	0.16
468	0.22
469	0.26
470	0.29
471	0.35
472	0.42
473	0.45
474	0.49
475	0.52
476	0.54
477	0.53
478	0.59
479	0.6
480	0.62
481	0.66
482	0.64
483	0.64
484	0.57

A0A0C4E0E4

3D AlphaFold-predicted Structure Viewer