Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4S744

Protein Details
Accession F4S744    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-105HEELNRLRRKRRRNRTDEDIAABasic
NLS Segment(s)
PositionSequence
90-97LRRKRRRN
Subcellular Location(s) nucl 18, cyto 6, mito 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_94273  -  
Amino Acid Sequences MRFDAEMQSKVKIAEDRLEVASKTLQRLQARDESYTLEYFSSQWERQKRCQITAMADDAAETQERMEQCLLELLELQEEVKHAHEELNRLRRKRRRNRTDEDIAATLTLPASIVALETAILDVTEELGSEEFRRLHQATSPKALALIGVRLAKMKLYEAKVGIVEAQKKWDKEVEGDEETYEQETNDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.3
5 0.32
6 0.28
7 0.27
8 0.29
9 0.25
10 0.27
11 0.27
12 0.32
13 0.33
14 0.35
15 0.38
16 0.41
17 0.41
18 0.39
19 0.36
20 0.33
21 0.32
22 0.3
23 0.26
24 0.18
25 0.16
26 0.14
27 0.18
28 0.2
29 0.2
30 0.26
31 0.35
32 0.4
33 0.47
34 0.57
35 0.57
36 0.54
37 0.57
38 0.53
39 0.49
40 0.47
41 0.42
42 0.32
43 0.28
44 0.24
45 0.19
46 0.16
47 0.12
48 0.08
49 0.05
50 0.08
51 0.08
52 0.1
53 0.1
54 0.09
55 0.09
56 0.12
57 0.11
58 0.09
59 0.09
60 0.07
61 0.07
62 0.07
63 0.07
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.1
71 0.11
72 0.16
73 0.22
74 0.31
75 0.35
76 0.37
77 0.45
78 0.5
79 0.59
80 0.66
81 0.71
82 0.72
83 0.77
84 0.82
85 0.82
86 0.82
87 0.73
88 0.65
89 0.54
90 0.43
91 0.34
92 0.26
93 0.17
94 0.1
95 0.07
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.06
117 0.08
118 0.08
119 0.09
120 0.14
121 0.15
122 0.16
123 0.2
124 0.27
125 0.29
126 0.34
127 0.34
128 0.29
129 0.28
130 0.27
131 0.23
132 0.17
133 0.14
134 0.12
135 0.12
136 0.12
137 0.13
138 0.13
139 0.14
140 0.13
141 0.16
142 0.19
143 0.21
144 0.25
145 0.25
146 0.27
147 0.26
148 0.25
149 0.25
150 0.23
151 0.24
152 0.21
153 0.29
154 0.32
155 0.32
156 0.35
157 0.37
158 0.34
159 0.34
160 0.39
161 0.38
162 0.36
163 0.36
164 0.34
165 0.3
166 0.29
167 0.26
168 0.2