Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DU49

Protein Details
Accession A0A0C4DU49   
Localization Confidence High
Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-66VKLRARAPARSPKAPKKPKTPKKPSSDRPRFQDVGHydrophilic
118-141AGNPKASKKPKTPKKPSPLPPRMGHydrophilic
184-217AAKLHARARKAPKTPKTPKKPKKPSPKLGFQDDMHydrophilic
NLS Segment(s)
PositionSequence
27-57RGEAPVKLRARAPARSPKAPKKPKTPKKPSS
112-135LRARAPAGNPKASKKPKTPKKPSP
185-210AKLHARARKAPKTPKTPKKPKKPSPK
Subcellular Location(s) mito 14, nucl 7, extr 4
Family & Domain DBs
Amino Acid Sequences MYIKEPSPTLILLQKGVSCAAHGRCKRGEAPVKLRARAPARSPKAPKKPKTPKKPSSDRPRFQDVGDCSTGLCGPRTGAPTEPSPEVKKLIWEAGDCTTGLCGRSDEAADKLRARAPAGNPKASKKPKTPKKPSPLPPRMGDCSTGLCGGRTGAPAEELSPELKQQLRKMRDCTTGLCQRGEPAAKLHARARKAPKTPKTPKKPKKPSPKLGFQDDMGDCSTGLCRNRPAPEPKTDCDTGLCRRGEVDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.21
4 0.18
5 0.14
6 0.19
7 0.23
8 0.31
9 0.33
10 0.38
11 0.39
12 0.44
13 0.45
14 0.49
15 0.53
16 0.53
17 0.58
18 0.62
19 0.65
20 0.63
21 0.62
22 0.6
23 0.56
24 0.52
25 0.52
26 0.54
27 0.54
28 0.62
29 0.69
30 0.71
31 0.77
32 0.82
33 0.82
34 0.82
35 0.87
36 0.88
37 0.91
38 0.91
39 0.9
40 0.9
41 0.92
42 0.91
43 0.92
44 0.92
45 0.88
46 0.83
47 0.82
48 0.73
49 0.62
50 0.6
51 0.52
52 0.47
53 0.4
54 0.34
55 0.25
56 0.24
57 0.25
58 0.17
59 0.15
60 0.09
61 0.09
62 0.12
63 0.14
64 0.15
65 0.16
66 0.18
67 0.2
68 0.22
69 0.24
70 0.24
71 0.24
72 0.24
73 0.25
74 0.22
75 0.22
76 0.21
77 0.21
78 0.19
79 0.16
80 0.17
81 0.16
82 0.17
83 0.14
84 0.13
85 0.11
86 0.1
87 0.1
88 0.08
89 0.07
90 0.07
91 0.07
92 0.08
93 0.08
94 0.1
95 0.13
96 0.14
97 0.14
98 0.15
99 0.17
100 0.17
101 0.17
102 0.19
103 0.2
104 0.29
105 0.31
106 0.36
107 0.35
108 0.37
109 0.46
110 0.48
111 0.5
112 0.49
113 0.56
114 0.61
115 0.7
116 0.77
117 0.78
118 0.81
119 0.86
120 0.86
121 0.87
122 0.85
123 0.79
124 0.72
125 0.67
126 0.62
127 0.53
128 0.44
129 0.34
130 0.27
131 0.23
132 0.21
133 0.16
134 0.12
135 0.11
136 0.1
137 0.1
138 0.08
139 0.08
140 0.07
141 0.08
142 0.08
143 0.08
144 0.09
145 0.09
146 0.09
147 0.08
148 0.09
149 0.1
150 0.13
151 0.16
152 0.21
153 0.3
154 0.36
155 0.41
156 0.46
157 0.49
158 0.53
159 0.52
160 0.49
161 0.48
162 0.48
163 0.45
164 0.41
165 0.36
166 0.31
167 0.34
168 0.32
169 0.25
170 0.19
171 0.24
172 0.25
173 0.28
174 0.32
175 0.33
176 0.34
177 0.42
178 0.49
179 0.51
180 0.58
181 0.66
182 0.69
183 0.75
184 0.83
185 0.85
186 0.87
187 0.9
188 0.91
189 0.92
190 0.94
191 0.93
192 0.94
193 0.94
194 0.94
195 0.92
196 0.92
197 0.87
198 0.84
199 0.77
200 0.66
201 0.63
202 0.52
203 0.45
204 0.35
205 0.29
206 0.21
207 0.18
208 0.19
209 0.16
210 0.18
211 0.19
212 0.24
213 0.29
214 0.35
215 0.42
216 0.49
217 0.5
218 0.58
219 0.61
220 0.6
221 0.61
222 0.58
223 0.51
224 0.47
225 0.47
226 0.44
227 0.45
228 0.42
229 0.35
230 0.34