Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EA33

Protein Details
Accession A0A0C4EA33   
Localization Confidence Low
Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-106LYVFACRKKSCRRQAGSVRAIRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, cyto_nucl 11.5, pero 3, nucl 2, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007320  PDCD2_C  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF04194  PDCD2_C  
Amino Acid Sequences MVSYDSDSSGEDEQFTETNVLLGYTSKDAGSETVSRLGGRPDWLVADKPPTAALARCKVCKDLTVLLLQLNGELPERFPGHERRLYVFACRKKSCRRQAGSVRAIRGLKVSGEAAAAAERKQAAEKQKAAAAKEASKPVASTGLGESLFGVKAPAGGAGGVNPFAAPAPGANPFSSAPQASAANPFSTKPAGEGKKQKEEEQKKEESKTEKAAAELPQTFAEKLALNNPQVSGPPPAPEPWPAESEPGQPRPYPVSWIAEAEYETLDPWPMPAVPTGPTAMELDEEEVGSGSGGKGKGKGKEDKEAIVDLEDGDEDADVLDGMDWGTIIVGVCSRDCQERTVGDGEAGYLEEWAGVQWEELMVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.11
5 0.12
6 0.11
7 0.1
8 0.08
9 0.09
10 0.1
11 0.11
12 0.12
13 0.11
14 0.11
15 0.12
16 0.13
17 0.16
18 0.16
19 0.17
20 0.21
21 0.21
22 0.22
23 0.22
24 0.24
25 0.23
26 0.22
27 0.21
28 0.18
29 0.2
30 0.22
31 0.23
32 0.22
33 0.25
34 0.23
35 0.22
36 0.22
37 0.2
38 0.2
39 0.21
40 0.26
41 0.29
42 0.33
43 0.36
44 0.38
45 0.4
46 0.39
47 0.38
48 0.37
49 0.33
50 0.31
51 0.29
52 0.28
53 0.25
54 0.25
55 0.22
56 0.17
57 0.13
58 0.11
59 0.09
60 0.09
61 0.09
62 0.12
63 0.13
64 0.14
65 0.18
66 0.25
67 0.31
68 0.35
69 0.37
70 0.36
71 0.4
72 0.4
73 0.44
74 0.46
75 0.46
76 0.51
77 0.53
78 0.57
79 0.62
80 0.72
81 0.74
82 0.76
83 0.74
84 0.75
85 0.81
86 0.84
87 0.82
88 0.77
89 0.68
90 0.62
91 0.57
92 0.47
93 0.39
94 0.29
95 0.2
96 0.17
97 0.15
98 0.1
99 0.1
100 0.09
101 0.08
102 0.09
103 0.09
104 0.07
105 0.09
106 0.08
107 0.09
108 0.1
109 0.15
110 0.2
111 0.27
112 0.29
113 0.29
114 0.33
115 0.35
116 0.34
117 0.34
118 0.3
119 0.27
120 0.29
121 0.3
122 0.28
123 0.25
124 0.24
125 0.2
126 0.2
127 0.15
128 0.12
129 0.1
130 0.12
131 0.12
132 0.11
133 0.11
134 0.09
135 0.09
136 0.08
137 0.07
138 0.04
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.03
154 0.03
155 0.04
156 0.07
157 0.08
158 0.08
159 0.1
160 0.1
161 0.11
162 0.12
163 0.11
164 0.09
165 0.09
166 0.1
167 0.09
168 0.12
169 0.12
170 0.11
171 0.12
172 0.11
173 0.11
174 0.11
175 0.11
176 0.09
177 0.17
178 0.19
179 0.25
180 0.33
181 0.37
182 0.46
183 0.47
184 0.52
185 0.54
186 0.6
187 0.63
188 0.61
189 0.64
190 0.59
191 0.6
192 0.59
193 0.53
194 0.48
195 0.44
196 0.41
197 0.34
198 0.31
199 0.31
200 0.28
201 0.28
202 0.25
203 0.22
204 0.19
205 0.19
206 0.18
207 0.15
208 0.15
209 0.11
210 0.11
211 0.14
212 0.16
213 0.16
214 0.17
215 0.17
216 0.16
217 0.16
218 0.17
219 0.15
220 0.12
221 0.13
222 0.14
223 0.15
224 0.16
225 0.18
226 0.2
227 0.19
228 0.22
229 0.21
230 0.23
231 0.24
232 0.29
233 0.32
234 0.33
235 0.33
236 0.3
237 0.31
238 0.33
239 0.32
240 0.29
241 0.26
242 0.25
243 0.24
244 0.25
245 0.24
246 0.2
247 0.19
248 0.16
249 0.14
250 0.1
251 0.09
252 0.08
253 0.07
254 0.06
255 0.06
256 0.06
257 0.06
258 0.07
259 0.08
260 0.09
261 0.1
262 0.11
263 0.12
264 0.11
265 0.12
266 0.12
267 0.11
268 0.11
269 0.09
270 0.1
271 0.09
272 0.09
273 0.08
274 0.07
275 0.07
276 0.06
277 0.06
278 0.04
279 0.08
280 0.09
281 0.1
282 0.15
283 0.2
284 0.26
285 0.33
286 0.42
287 0.43
288 0.51
289 0.53
290 0.52
291 0.5
292 0.45
293 0.39
294 0.31
295 0.27
296 0.17
297 0.15
298 0.11
299 0.09
300 0.07
301 0.06
302 0.05
303 0.04
304 0.04
305 0.04
306 0.04
307 0.04
308 0.04
309 0.04
310 0.04
311 0.04
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.06
318 0.07
319 0.08
320 0.1
321 0.12
322 0.18
323 0.19
324 0.21
325 0.25
326 0.25
327 0.3
328 0.31
329 0.29
330 0.23
331 0.22
332 0.2
333 0.16
334 0.15
335 0.1
336 0.07
337 0.07
338 0.06
339 0.06
340 0.05
341 0.06
342 0.06
343 0.06
344 0.06
345 0.07