Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E4T7

Protein Details
Accession A0A0C4E4T7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-125AAVYRTYRKQYKHKPRRARRSRNGGRIEVHydrophilic
NLS Segment(s)
PositionSequence
105-121KQYKHKPRRARRSRNGG
Subcellular Location(s) cyto 15, nucl 8, cyto_pero 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013952  DUF1776_fun  
IPR036291  NAD(P)-bd_dom_sf  
Pfam View protein in Pfam  
PF08643  DUF1776  
Amino Acid Sequences MSADDQVFLDVLSAIPNDIKRYSGEVADFVDKHVEAAAGVLRERLSTIEWIPDSIRPRPLPPAPSAQLLPLSAFERLESWMSRHKILTGLIVLGTGAAVYRTYRKQYKHKPRRARRSRNGGRIEVVVIAGKPSLPLVKSLAMDLERRGHIVFIVCNSVEEDAIVQNMQRSDIKPLAVDIADPPLAGASIERFAQYLHAPHPPTSKAKPNYLTLKAVVVVPSVTYQTAPIATIPPSGFAELFHTHLLHPILTVQSFLPLLTARPSPPPVSPAPAAAAAAGSPAPSPTSSSSSHNQGPPKVVVCTPSIVSSINPPFHAPEATPSPTSLGGTPRSGSESGEFVAVPGGDSSFVRILGAAVWYPSFASNDITAPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.12
4 0.15
5 0.16
6 0.17
7 0.17
8 0.22
9 0.24
10 0.24
11 0.24
12 0.22
13 0.25
14 0.29
15 0.28
16 0.23
17 0.24
18 0.21
19 0.2
20 0.19
21 0.15
22 0.09
23 0.11
24 0.12
25 0.1
26 0.11
27 0.12
28 0.11
29 0.11
30 0.12
31 0.12
32 0.11
33 0.13
34 0.14
35 0.19
36 0.19
37 0.2
38 0.21
39 0.25
40 0.28
41 0.29
42 0.35
43 0.31
44 0.33
45 0.4
46 0.44
47 0.44
48 0.44
49 0.48
50 0.43
51 0.44
52 0.42
53 0.36
54 0.32
55 0.28
56 0.25
57 0.18
58 0.17
59 0.14
60 0.14
61 0.12
62 0.11
63 0.12
64 0.14
65 0.13
66 0.15
67 0.22
68 0.25
69 0.27
70 0.27
71 0.26
72 0.26
73 0.26
74 0.26
75 0.18
76 0.16
77 0.14
78 0.13
79 0.12
80 0.09
81 0.08
82 0.04
83 0.03
84 0.03
85 0.03
86 0.04
87 0.09
88 0.13
89 0.2
90 0.26
91 0.33
92 0.43
93 0.54
94 0.65
95 0.72
96 0.79
97 0.84
98 0.89
99 0.94
100 0.95
101 0.95
102 0.94
103 0.94
104 0.93
105 0.92
106 0.87
107 0.78
108 0.69
109 0.58
110 0.49
111 0.38
112 0.28
113 0.18
114 0.12
115 0.1
116 0.08
117 0.06
118 0.05
119 0.06
120 0.07
121 0.07
122 0.08
123 0.1
124 0.13
125 0.13
126 0.13
127 0.15
128 0.14
129 0.15
130 0.15
131 0.17
132 0.14
133 0.15
134 0.15
135 0.13
136 0.12
137 0.12
138 0.11
139 0.09
140 0.1
141 0.09
142 0.09
143 0.1
144 0.09
145 0.08
146 0.07
147 0.07
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.08
156 0.09
157 0.13
158 0.15
159 0.15
160 0.13
161 0.13
162 0.13
163 0.12
164 0.11
165 0.08
166 0.08
167 0.08
168 0.07
169 0.07
170 0.05
171 0.05
172 0.05
173 0.04
174 0.03
175 0.04
176 0.05
177 0.05
178 0.05
179 0.05
180 0.07
181 0.08
182 0.09
183 0.1
184 0.14
185 0.16
186 0.17
187 0.2
188 0.21
189 0.25
190 0.27
191 0.34
192 0.33
193 0.38
194 0.4
195 0.43
196 0.47
197 0.46
198 0.44
199 0.35
200 0.32
201 0.27
202 0.24
203 0.19
204 0.12
205 0.09
206 0.07
207 0.07
208 0.07
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.07
217 0.08
218 0.1
219 0.1
220 0.11
221 0.11
222 0.12
223 0.11
224 0.1
225 0.14
226 0.13
227 0.15
228 0.14
229 0.14
230 0.13
231 0.16
232 0.17
233 0.12
234 0.11
235 0.1
236 0.11
237 0.1
238 0.11
239 0.08
240 0.08
241 0.09
242 0.08
243 0.08
244 0.07
245 0.08
246 0.1
247 0.11
248 0.11
249 0.15
250 0.18
251 0.19
252 0.2
253 0.23
254 0.23
255 0.26
256 0.25
257 0.23
258 0.22
259 0.2
260 0.19
261 0.15
262 0.13
263 0.08
264 0.08
265 0.07
266 0.05
267 0.04
268 0.05
269 0.06
270 0.06
271 0.09
272 0.11
273 0.15
274 0.17
275 0.22
276 0.26
277 0.31
278 0.36
279 0.38
280 0.4
281 0.39
282 0.41
283 0.39
284 0.38
285 0.35
286 0.3
287 0.28
288 0.25
289 0.25
290 0.21
291 0.19
292 0.18
293 0.16
294 0.16
295 0.21
296 0.26
297 0.25
298 0.25
299 0.25
300 0.26
301 0.27
302 0.28
303 0.21
304 0.21
305 0.25
306 0.28
307 0.27
308 0.25
309 0.26
310 0.25
311 0.26
312 0.22
313 0.21
314 0.2
315 0.22
316 0.22
317 0.21
318 0.25
319 0.24
320 0.23
321 0.2
322 0.19
323 0.17
324 0.18
325 0.16
326 0.12
327 0.14
328 0.12
329 0.1
330 0.09
331 0.08
332 0.08
333 0.09
334 0.12
335 0.11
336 0.11
337 0.11
338 0.11
339 0.1
340 0.11
341 0.12
342 0.09
343 0.09
344 0.1
345 0.1
346 0.11
347 0.12
348 0.12
349 0.11
350 0.14
351 0.14