Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DV70

Protein Details
Accession A0A0C4DV70    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-43DASSARIKKNKKSNQVKFKVRCQTHHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKNKK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKFIEICRRKDASSARIKKNKKSNQVKFKVRCQTHLYTLILKDAEKAEKLKQSLPPSLTVTEVSRKERKSKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.55
7 0.53
8 0.57
9 0.61
10 0.6
11 0.67
12 0.71
13 0.72
14 0.77
15 0.76
16 0.76
17 0.78
18 0.78
19 0.8
20 0.86
21 0.88
22 0.82
23 0.82
24 0.8
25 0.7
26 0.65
27 0.6
28 0.54
29 0.48
30 0.47
31 0.4
32 0.33
33 0.32
34 0.29
35 0.23
36 0.2
37 0.17
38 0.14
39 0.15
40 0.14
41 0.16
42 0.18
43 0.23
44 0.25
45 0.27
46 0.32
47 0.36
48 0.4
49 0.4
50 0.4
51 0.38
52 0.37
53 0.34
54 0.29
55 0.27
56 0.29
57 0.32
58 0.35
59 0.39
60 0.42
61 0.5