Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EGP5

Protein Details
Accession A0A0C4EGP5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
193-229GSRHDKSKIPCPRCHRNIKGARKDNLRRHLRIKHGVSBasic
NLS Segment(s)
PositionSequence
211-223KGARKDNLRRHLR
Subcellular Location(s) nucl 13, cyto 5, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MNSITLAVCGGGPGFNGEQQQQQQCDDSGEAAAIDRIWESWHLEGAELDELVELLADRMHASRHQDGDHMIGVLVDDVDEQQPRHQDNDNKEDDINDWTPTFPLSAYMADKLKPAAATTITPPTPSGSGTAAPELTRASSSSAATASSMRSPGTPRAGGEGAPPLLHPRPFRCAKPGCKSAFKQKRDLMRHVGSRHDKSKIPCPRCHRNIKGARKDNLRRHLRIKHGVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.14
4 0.15
5 0.21
6 0.27
7 0.32
8 0.31
9 0.32
10 0.32
11 0.31
12 0.32
13 0.27
14 0.21
15 0.15
16 0.13
17 0.12
18 0.1
19 0.09
20 0.07
21 0.06
22 0.06
23 0.05
24 0.06
25 0.08
26 0.1
27 0.1
28 0.13
29 0.13
30 0.13
31 0.13
32 0.14
33 0.13
34 0.11
35 0.1
36 0.07
37 0.07
38 0.06
39 0.06
40 0.04
41 0.03
42 0.03
43 0.03
44 0.04
45 0.05
46 0.06
47 0.09
48 0.14
49 0.18
50 0.2
51 0.21
52 0.22
53 0.22
54 0.23
55 0.22
56 0.17
57 0.12
58 0.1
59 0.09
60 0.08
61 0.07
62 0.04
63 0.03
64 0.04
65 0.05
66 0.06
67 0.07
68 0.09
69 0.13
70 0.14
71 0.17
72 0.22
73 0.26
74 0.32
75 0.39
76 0.4
77 0.37
78 0.36
79 0.34
80 0.3
81 0.28
82 0.23
83 0.16
84 0.14
85 0.12
86 0.12
87 0.12
88 0.11
89 0.06
90 0.07
91 0.07
92 0.08
93 0.09
94 0.11
95 0.11
96 0.11
97 0.12
98 0.11
99 0.1
100 0.09
101 0.08
102 0.07
103 0.08
104 0.08
105 0.1
106 0.14
107 0.13
108 0.13
109 0.13
110 0.13
111 0.12
112 0.12
113 0.12
114 0.09
115 0.1
116 0.1
117 0.11
118 0.1
119 0.09
120 0.1
121 0.08
122 0.08
123 0.07
124 0.07
125 0.08
126 0.09
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.09
134 0.09
135 0.09
136 0.09
137 0.1
138 0.12
139 0.16
140 0.2
141 0.2
142 0.19
143 0.23
144 0.23
145 0.22
146 0.21
147 0.2
148 0.16
149 0.15
150 0.14
151 0.14
152 0.16
153 0.2
154 0.22
155 0.21
156 0.29
157 0.34
158 0.36
159 0.41
160 0.47
161 0.53
162 0.59
163 0.64
164 0.61
165 0.65
166 0.67
167 0.7
168 0.71
169 0.66
170 0.67
171 0.64
172 0.69
173 0.68
174 0.7
175 0.68
176 0.65
177 0.68
178 0.61
179 0.65
180 0.63
181 0.63
182 0.62
183 0.57
184 0.55
185 0.52
186 0.6
187 0.61
188 0.6
189 0.61
190 0.65
191 0.71
192 0.76
193 0.82
194 0.79
195 0.79
196 0.83
197 0.85
198 0.88
199 0.86
200 0.85
201 0.85
202 0.88
203 0.87
204 0.87
205 0.85
206 0.81
207 0.8
208 0.81
209 0.8