Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DY60

Protein Details
Accession A0A0C4DY60    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-96ADPNNPKRKTPPPKYTKNKSPSPKKAPSPKKAPSPKSSGGKKPRRNAEARAHydrophilic
NLS Segment(s)
PositionSequence
51-95PKRKTPPPKYTKNKSPSPKKAPSPKKAPSPKSSGGKKPRRNAEAR
Subcellular Location(s) extr 17, mito 4, plas 2, pero 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MHATSFLLVLFGATAAVAKLELICDKPAPLRTCKIDFLEFVEPYVADPNNPKRKTPPPKYTKNKSPSPKKAPSPKKAPSPKSSGGKKPRRNAEARAFHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.04
4 0.04
5 0.03
6 0.04
7 0.05
8 0.06
9 0.08
10 0.09
11 0.1
12 0.11
13 0.15
14 0.22
15 0.24
16 0.27
17 0.3
18 0.34
19 0.37
20 0.39
21 0.38
22 0.33
23 0.3
24 0.31
25 0.31
26 0.26
27 0.23
28 0.2
29 0.16
30 0.15
31 0.17
32 0.12
33 0.07
34 0.12
35 0.21
36 0.31
37 0.32
38 0.32
39 0.35
40 0.46
41 0.56
42 0.62
43 0.63
44 0.62
45 0.72
46 0.81
47 0.85
48 0.84
49 0.81
50 0.81
51 0.8
52 0.82
53 0.82
54 0.82
55 0.81
56 0.8
57 0.84
58 0.85
59 0.84
60 0.83
61 0.79
62 0.8
63 0.82
64 0.81
65 0.76
66 0.75
67 0.74
68 0.74
69 0.75
70 0.74
71 0.75
72 0.78
73 0.81
74 0.82
75 0.84
76 0.83
77 0.81
78 0.8
79 0.8