Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E347

Protein Details
Accession A0A0C4E347    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
114-137ALGLACPRRRCRPRRAVAAARAALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037202  ESCRT_assembly_dom  
IPR007143  Vps28  
IPR017898  VPS28_N  
IPR038358  VPS28_N_sf  
Gene Ontology GO:0000813  C:ESCRT I complex  
GO:0032509  P:endosome transport via multivesicular body sorting pathway  
GO:0072666  P:establishment of protein localization to vacuole  
GO:0006886  P:intracellular protein transport  
GO:0043162  P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
GO:0007034  P:vacuolar transport  
Pfam View protein in Pfam  
PF03997  VPS28  
PROSITE View protein in PROSITE  
PS51313  VPS28_N  
Amino Acid Sequences MMPRQGYAPTPHSYVPNTAMSATISLDDEVRLADTRAERDLQDSLAEIFSIIVTIDELEKAFLKDAIPESDYTDICERSLKQYRSILTDETVATAFGDLEEFKAEWDFPAPQSALGLACPRRRCRPRRAVAAARAALET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.29
4 0.26
5 0.23
6 0.22
7 0.2
8 0.18
9 0.15
10 0.12
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.07
17 0.08
18 0.08
19 0.07
20 0.1
21 0.11
22 0.13
23 0.15
24 0.16
25 0.15
26 0.17
27 0.17
28 0.15
29 0.13
30 0.12
31 0.11
32 0.09
33 0.09
34 0.07
35 0.06
36 0.05
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.07
52 0.09
53 0.1
54 0.1
55 0.1
56 0.11
57 0.13
58 0.13
59 0.13
60 0.14
61 0.12
62 0.12
63 0.13
64 0.12
65 0.17
66 0.26
67 0.26
68 0.28
69 0.32
70 0.33
71 0.36
72 0.37
73 0.31
74 0.23
75 0.24
76 0.19
77 0.16
78 0.15
79 0.11
80 0.09
81 0.08
82 0.07
83 0.05
84 0.05
85 0.04
86 0.05
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.07
93 0.1
94 0.11
95 0.1
96 0.14
97 0.14
98 0.13
99 0.14
100 0.14
101 0.12
102 0.12
103 0.17
104 0.19
105 0.25
106 0.32
107 0.37
108 0.48
109 0.58
110 0.64
111 0.7
112 0.75
113 0.79
114 0.83
115 0.87
116 0.86
117 0.84
118 0.85
119 0.77