Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DVN0

Protein Details
Accession A0A0C4DVN0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-41QQSPPRRPPPQTKLKKHGSEKBasic
NLS Segment(s)
PositionSequence
33-36KLKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MASAWAANGDQPPQPPQQQQQQSPPRRPPPQTKLKKHGSEKSSLSTTRSGSTSGKSSKSSKSSRSTASGAKASSRKPGSTATTRQGSSRRVAATR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.37
4 0.45
5 0.51
6 0.54
7 0.6
8 0.66
9 0.7
10 0.74
11 0.77
12 0.76
13 0.76
14 0.77
15 0.77
16 0.76
17 0.78
18 0.8
19 0.8
20 0.79
21 0.81
22 0.83
23 0.8
24 0.78
25 0.7
26 0.66
27 0.59
28 0.54
29 0.48
30 0.4
31 0.34
32 0.29
33 0.26
34 0.22
35 0.2
36 0.18
37 0.15
38 0.16
39 0.19
40 0.2
41 0.21
42 0.23
43 0.26
44 0.29
45 0.36
46 0.39
47 0.41
48 0.44
49 0.46
50 0.47
51 0.48
52 0.46
53 0.42
54 0.42
55 0.38
56 0.33
57 0.34
58 0.34
59 0.31
60 0.37
61 0.36
62 0.32
63 0.31
64 0.36
65 0.37
66 0.41
67 0.46
68 0.44
69 0.47
70 0.47
71 0.49
72 0.5
73 0.47
74 0.44
75 0.43