Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EFX0

Protein Details
Accession A0A0C4EFX0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-96KEKYKQYYDCNEPKPRRKDCBasic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8, extr 3, cyto 1, plas 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MHFSHLIIALSVSLAAASPASRPNDECPKWRGISKLWNGIGCCTRSTSPTYCCQLPGDVVNWYNKSLPCTSEWWQTKEKYKQYYDCNEPKPRRKDCAGVPIVRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.06
6 0.1
7 0.13
8 0.15
9 0.17
10 0.23
11 0.33
12 0.36
13 0.4
14 0.39
15 0.43
16 0.43
17 0.44
18 0.41
19 0.34
20 0.41
21 0.42
22 0.46
23 0.42
24 0.42
25 0.4
26 0.4
27 0.39
28 0.3
29 0.25
30 0.19
31 0.17
32 0.17
33 0.21
34 0.21
35 0.21
36 0.25
37 0.28
38 0.26
39 0.26
40 0.25
41 0.21
42 0.19
43 0.17
44 0.13
45 0.12
46 0.13
47 0.15
48 0.15
49 0.15
50 0.17
51 0.17
52 0.19
53 0.18
54 0.18
55 0.17
56 0.22
57 0.24
58 0.31
59 0.34
60 0.35
61 0.39
62 0.43
63 0.5
64 0.54
65 0.58
66 0.57
67 0.6
68 0.62
69 0.65
70 0.7
71 0.7
72 0.7
73 0.71
74 0.73
75 0.77
76 0.79
77 0.81
78 0.8
79 0.78
80 0.74
81 0.73
82 0.71
83 0.72
84 0.7