Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EBF7

Protein Details
Accession A0A0C4EBF7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-89ESNPDVRRSRTRSRSPIKSRRIAPLSHydrophilic
NLS Segment(s)
PositionSequence
75-81RSRSPIK
Subcellular Location(s) plas 17, mito 5, cyto 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
GO:0016779  F:nucleotidyltransferase activity  
Amino Acid Sequences MSAVARRLPTTRVISPSPTPSERLQDDQAHSQDSYIGPTTRSAARKRLSTPQPVEEDIDEDEYESNPDVRRSRTRSRSPIKSRRIAPLSSTNGAKATKVSKTKATTLAPTPQNAVSEKKSNGSATNGAPSLPAIKTNGHLAPPSTAPPSSTSYWSWRDFSRSPSPLGLIPIHRHWRTFVHKYEVPRKILHVSIGFVVVWLYLRGTQTDAVWPWLLAALVPISVVDLLRHHHPGFNRVYVSVLGALMRESEFSGYNGVIFYLLGALIVLYCFPKDVGVVGTLLLSWCDTAASTFGRLYGAYTPRIRRGKSLAGSSAAFLVGVATAASFWGWLVPTYGPLPGDEAFMFRGSLSLPSAVAEPLGLSASQATASGPVALGVVSLWSGFVAAASEVVDVFGWDDNLTIPVLSGFFIWGFLKIFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.52
4 0.52
5 0.48
6 0.46
7 0.43
8 0.48
9 0.46
10 0.47
11 0.46
12 0.46
13 0.48
14 0.52
15 0.51
16 0.46
17 0.42
18 0.37
19 0.33
20 0.26
21 0.26
22 0.22
23 0.2
24 0.18
25 0.19
26 0.23
27 0.26
28 0.33
29 0.34
30 0.39
31 0.43
32 0.49
33 0.52
34 0.59
35 0.61
36 0.64
37 0.65
38 0.63
39 0.63
40 0.59
41 0.57
42 0.47
43 0.41
44 0.32
45 0.28
46 0.21
47 0.17
48 0.15
49 0.13
50 0.14
51 0.13
52 0.13
53 0.13
54 0.18
55 0.21
56 0.26
57 0.35
58 0.42
59 0.51
60 0.59
61 0.67
62 0.73
63 0.79
64 0.84
65 0.86
66 0.89
67 0.88
68 0.86
69 0.81
70 0.8
71 0.76
72 0.66
73 0.6
74 0.59
75 0.56
76 0.5
77 0.47
78 0.37
79 0.36
80 0.34
81 0.29
82 0.23
83 0.21
84 0.25
85 0.3
86 0.32
87 0.37
88 0.4
89 0.45
90 0.48
91 0.47
92 0.44
93 0.43
94 0.49
95 0.44
96 0.41
97 0.39
98 0.33
99 0.33
100 0.3
101 0.3
102 0.25
103 0.29
104 0.29
105 0.28
106 0.29
107 0.28
108 0.28
109 0.28
110 0.27
111 0.23
112 0.25
113 0.23
114 0.2
115 0.19
116 0.17
117 0.16
118 0.13
119 0.13
120 0.11
121 0.12
122 0.13
123 0.17
124 0.18
125 0.16
126 0.17
127 0.16
128 0.17
129 0.17
130 0.18
131 0.16
132 0.14
133 0.14
134 0.16
135 0.2
136 0.2
137 0.21
138 0.21
139 0.25
140 0.3
141 0.32
142 0.31
143 0.27
144 0.32
145 0.31
146 0.36
147 0.39
148 0.36
149 0.36
150 0.34
151 0.34
152 0.29
153 0.3
154 0.26
155 0.19
156 0.2
157 0.24
158 0.3
159 0.29
160 0.29
161 0.28
162 0.32
163 0.37
164 0.41
165 0.39
166 0.39
167 0.42
168 0.47
169 0.55
170 0.55
171 0.5
172 0.44
173 0.42
174 0.38
175 0.36
176 0.32
177 0.23
178 0.18
179 0.15
180 0.15
181 0.12
182 0.1
183 0.09
184 0.06
185 0.05
186 0.04
187 0.04
188 0.05
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.1
195 0.1
196 0.1
197 0.1
198 0.09
199 0.08
200 0.08
201 0.07
202 0.05
203 0.05
204 0.04
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.04
213 0.06
214 0.08
215 0.11
216 0.11
217 0.14
218 0.15
219 0.21
220 0.23
221 0.24
222 0.23
223 0.2
224 0.21
225 0.19
226 0.18
227 0.12
228 0.1
229 0.07
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.07
239 0.08
240 0.07
241 0.07
242 0.07
243 0.07
244 0.06
245 0.05
246 0.04
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.02
253 0.03
254 0.03
255 0.03
256 0.03
257 0.04
258 0.04
259 0.04
260 0.04
261 0.05
262 0.06
263 0.06
264 0.07
265 0.07
266 0.07
267 0.06
268 0.06
269 0.06
270 0.04
271 0.04
272 0.03
273 0.03
274 0.03
275 0.04
276 0.06
277 0.07
278 0.08
279 0.08
280 0.08
281 0.09
282 0.09
283 0.1
284 0.14
285 0.16
286 0.2
287 0.25
288 0.28
289 0.37
290 0.43
291 0.42
292 0.41
293 0.44
294 0.48
295 0.48
296 0.49
297 0.43
298 0.4
299 0.39
300 0.35
301 0.29
302 0.2
303 0.15
304 0.1
305 0.08
306 0.05
307 0.04
308 0.04
309 0.03
310 0.03
311 0.03
312 0.03
313 0.03
314 0.03
315 0.04
316 0.04
317 0.05
318 0.07
319 0.07
320 0.09
321 0.1
322 0.12
323 0.11
324 0.11
325 0.14
326 0.12
327 0.14
328 0.12
329 0.13
330 0.13
331 0.13
332 0.13
333 0.1
334 0.1
335 0.09
336 0.1
337 0.1
338 0.1
339 0.09
340 0.1
341 0.11
342 0.1
343 0.09
344 0.08
345 0.06
346 0.06
347 0.07
348 0.06
349 0.05
350 0.06
351 0.06
352 0.06
353 0.06
354 0.06
355 0.07
356 0.07
357 0.08
358 0.07
359 0.07
360 0.07
361 0.06
362 0.06
363 0.05
364 0.05
365 0.04
366 0.04
367 0.04
368 0.04
369 0.04
370 0.04
371 0.04
372 0.05
373 0.05
374 0.05
375 0.06
376 0.06
377 0.06
378 0.06
379 0.06
380 0.05
381 0.06
382 0.07
383 0.07
384 0.07
385 0.07
386 0.08
387 0.09
388 0.09
389 0.08
390 0.07
391 0.07
392 0.08
393 0.08
394 0.07
395 0.07
396 0.07
397 0.09
398 0.1
399 0.11