Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R7B3

Protein Details
Accession F4R7B3    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-107SSPPGSQPSVPRRKRKNTASQATAHydrophilic
270-297ADDLNLIKMKKRRKDSKKPRGYFHEIFFHydrophilic
NLS Segment(s)
PositionSequence
277-289KMKKRRKDSKKPR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_102138  -  
Amino Acid Sequences MGTLDSDNVSESDTSEFSQHVLPTPLRRSTRPPTPRKSLPGMVQPSADSRITVPLPQGPGSVSARKSRSRNVKTSDSQSLTINSSPPGSQPSVPRRKRKNTASQATAAQGSQPTLPVIAKEDEESDLSTPIVIDIPEEETNVPDEVDTDHDSEGDATAKAAPDYDEEEENQADTDDPTIALEAPILNGSHTNSSRKHANRLNGLISKANFVSRRVARLAAWRLHYSRIAKRMSLKLLPLTPGYNATRWNAEFDSLNRLVQARKVVNRLLADDLNLIKMKKRRKDSKKPRGYFHEIFFSQDDWTALEELTNELAVSLIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.17
6 0.16
7 0.17
8 0.21
9 0.23
10 0.3
11 0.36
12 0.42
13 0.43
14 0.46
15 0.51
16 0.54
17 0.62
18 0.65
19 0.69
20 0.7
21 0.75
22 0.79
23 0.78
24 0.78
25 0.73
26 0.69
27 0.68
28 0.66
29 0.58
30 0.51
31 0.45
32 0.4
33 0.37
34 0.31
35 0.22
36 0.17
37 0.2
38 0.2
39 0.21
40 0.19
41 0.2
42 0.22
43 0.22
44 0.22
45 0.17
46 0.21
47 0.24
48 0.27
49 0.26
50 0.3
51 0.35
52 0.41
53 0.44
54 0.49
55 0.56
56 0.59
57 0.65
58 0.64
59 0.68
60 0.67
61 0.7
62 0.69
63 0.61
64 0.54
65 0.47
66 0.43
67 0.36
68 0.32
69 0.26
70 0.18
71 0.16
72 0.15
73 0.14
74 0.16
75 0.16
76 0.18
77 0.25
78 0.35
79 0.45
80 0.53
81 0.62
82 0.67
83 0.75
84 0.82
85 0.83
86 0.84
87 0.83
88 0.84
89 0.79
90 0.72
91 0.64
92 0.56
93 0.47
94 0.36
95 0.26
96 0.18
97 0.14
98 0.11
99 0.1
100 0.08
101 0.08
102 0.08
103 0.07
104 0.1
105 0.1
106 0.1
107 0.1
108 0.11
109 0.11
110 0.12
111 0.12
112 0.1
113 0.09
114 0.09
115 0.08
116 0.07
117 0.06
118 0.06
119 0.05
120 0.04
121 0.04
122 0.08
123 0.08
124 0.09
125 0.09
126 0.08
127 0.1
128 0.1
129 0.09
130 0.05
131 0.06
132 0.06
133 0.08
134 0.1
135 0.09
136 0.09
137 0.09
138 0.09
139 0.09
140 0.09
141 0.07
142 0.05
143 0.05
144 0.05
145 0.06
146 0.05
147 0.06
148 0.05
149 0.05
150 0.08
151 0.09
152 0.09
153 0.09
154 0.11
155 0.11
156 0.1
157 0.09
158 0.07
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.06
176 0.1
177 0.12
178 0.16
179 0.16
180 0.2
181 0.28
182 0.3
183 0.37
184 0.39
185 0.43
186 0.46
187 0.48
188 0.5
189 0.45
190 0.44
191 0.39
192 0.34
193 0.3
194 0.24
195 0.25
196 0.2
197 0.19
198 0.25
199 0.24
200 0.27
201 0.26
202 0.27
203 0.25
204 0.32
205 0.37
206 0.33
207 0.35
208 0.35
209 0.35
210 0.36
211 0.39
212 0.37
213 0.36
214 0.39
215 0.38
216 0.37
217 0.42
218 0.45
219 0.46
220 0.43
221 0.4
222 0.37
223 0.37
224 0.36
225 0.31
226 0.26
227 0.22
228 0.24
229 0.24
230 0.21
231 0.21
232 0.21
233 0.24
234 0.24
235 0.27
236 0.23
237 0.22
238 0.22
239 0.21
240 0.28
241 0.24
242 0.24
243 0.2
244 0.21
245 0.21
246 0.22
247 0.28
248 0.26
249 0.3
250 0.34
251 0.36
252 0.4
253 0.4
254 0.39
255 0.36
256 0.31
257 0.27
258 0.25
259 0.23
260 0.22
261 0.22
262 0.2
263 0.21
264 0.27
265 0.35
266 0.42
267 0.52
268 0.6
269 0.69
270 0.8
271 0.86
272 0.91
273 0.93
274 0.91
275 0.9
276 0.88
277 0.87
278 0.81
279 0.74
280 0.73
281 0.62
282 0.59
283 0.51
284 0.42
285 0.34
286 0.29
287 0.25
288 0.16
289 0.17
290 0.14
291 0.12
292 0.12
293 0.11
294 0.11
295 0.12
296 0.11
297 0.09
298 0.07