Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E6D5

Protein Details
Accession A0A0C4E6D5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
30-49DASWRKPKGIDNRVRRRFKSBasic
NLS Segment(s)
PositionSequence
8-48VPIVKKRTKGFMRHQSDRFKRVDASWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 17.5, mito_nucl 11.333, cyto 5.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTKGFMRHQSDRFKRVDASWRKPKGIDNRVRRRFKSNLAMPSIGYGSNKKTRHMMPSGHKAFLVQNTNDVELLLMHNQTFAAEIAHNVSSRKRIDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.75
4 0.76
5 0.76
6 0.75
7 0.75
8 0.79
9 0.8
10 0.79
11 0.77
12 0.69
13 0.61
14 0.54
15 0.49
16 0.52
17 0.51
18 0.54
19 0.58
20 0.6
21 0.59
22 0.58
23 0.61
24 0.62
25 0.62
26 0.62
27 0.63
28 0.69
29 0.77
30 0.83
31 0.78
32 0.74
33 0.68
34 0.66
35 0.65
36 0.61
37 0.57
38 0.54
39 0.52
40 0.45
41 0.41
42 0.34
43 0.24
44 0.18
45 0.13
46 0.13
47 0.21
48 0.21
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.39
60 0.35
61 0.32
62 0.31
63 0.3
64 0.19
65 0.2
66 0.21
67 0.22
68 0.21
69 0.19
70 0.13
71 0.09
72 0.1
73 0.08
74 0.07
75 0.06
76 0.07
77 0.07
78 0.06
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.09
85 0.1
86 0.11
87 0.11
88 0.13
89 0.18
90 0.19
91 0.21
92 0.2
93 0.22
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47