Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DRH2

Protein Details
Accession A0A0C4DRH2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
169-197RTRLRVAKTRSQPRQQRRRREQEVRELVEHydrophilic
NLS Segment(s)
PositionSequence
168-188RRTRLRVAKTRSQPRQQRRRR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MDSACSSVPVTSSPAAGSATSPSSPAAASPEYSPGSSRSSSPLFVSSVAAGDDDDDDDKNNKGRGDDDDSAAGQREYNEQMERELYAAYVEIAKLRRQAVNDVSDLLGKFKIDDGRDGKPAQDLGGPADKVIQEIRGRAEKAVQDLSSALQDKDARIQRLRRTLTAERRTRLRVAKTRSQPRQQRRRREQEVRELVECGFWEDQYRYDVQHTAVRLRAEAEEDRSRLEAEYQLAASNFRQQLESQYQLAFSSYQNQVQTELQQVLRHIEGQYQLAFSSYQNQVQAQLQQVVQQLFQQPQQLFQQLFQQSQQSQQPHQWH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.14
5 0.13
6 0.15
7 0.14
8 0.15
9 0.14
10 0.14
11 0.13
12 0.13
13 0.15
14 0.13
15 0.14
16 0.15
17 0.2
18 0.2
19 0.21
20 0.22
21 0.2
22 0.23
23 0.22
24 0.23
25 0.23
26 0.25
27 0.26
28 0.26
29 0.26
30 0.23
31 0.23
32 0.22
33 0.17
34 0.15
35 0.14
36 0.12
37 0.09
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.1
44 0.11
45 0.13
46 0.16
47 0.19
48 0.19
49 0.19
50 0.21
51 0.24
52 0.31
53 0.32
54 0.3
55 0.29
56 0.28
57 0.28
58 0.27
59 0.21
60 0.13
61 0.12
62 0.13
63 0.14
64 0.16
65 0.18
66 0.17
67 0.18
68 0.19
69 0.18
70 0.15
71 0.13
72 0.1
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.08
79 0.1
80 0.12
81 0.15
82 0.17
83 0.19
84 0.2
85 0.25
86 0.27
87 0.29
88 0.28
89 0.25
90 0.23
91 0.23
92 0.21
93 0.17
94 0.13
95 0.09
96 0.09
97 0.11
98 0.14
99 0.13
100 0.2
101 0.22
102 0.25
103 0.28
104 0.28
105 0.26
106 0.24
107 0.23
108 0.18
109 0.16
110 0.13
111 0.12
112 0.16
113 0.16
114 0.14
115 0.15
116 0.14
117 0.13
118 0.13
119 0.14
120 0.11
121 0.12
122 0.15
123 0.17
124 0.18
125 0.17
126 0.2
127 0.18
128 0.19
129 0.2
130 0.18
131 0.14
132 0.14
133 0.14
134 0.13
135 0.13
136 0.1
137 0.1
138 0.11
139 0.11
140 0.18
141 0.21
142 0.22
143 0.24
144 0.3
145 0.33
146 0.41
147 0.43
148 0.38
149 0.41
150 0.45
151 0.52
152 0.56
153 0.56
154 0.5
155 0.52
156 0.53
157 0.51
158 0.49
159 0.47
160 0.45
161 0.47
162 0.54
163 0.59
164 0.66
165 0.69
166 0.73
167 0.74
168 0.77
169 0.82
170 0.82
171 0.84
172 0.84
173 0.87
174 0.87
175 0.88
176 0.84
177 0.84
178 0.83
179 0.75
180 0.66
181 0.56
182 0.46
183 0.37
184 0.3
185 0.22
186 0.13
187 0.1
188 0.11
189 0.11
190 0.12
191 0.13
192 0.13
193 0.12
194 0.13
195 0.15
196 0.14
197 0.17
198 0.17
199 0.18
200 0.2
201 0.2
202 0.18
203 0.18
204 0.17
205 0.17
206 0.18
207 0.21
208 0.22
209 0.22
210 0.23
211 0.22
212 0.22
213 0.19
214 0.19
215 0.16
216 0.13
217 0.14
218 0.13
219 0.14
220 0.13
221 0.14
222 0.14
223 0.19
224 0.18
225 0.17
226 0.18
227 0.17
228 0.24
229 0.29
230 0.31
231 0.26
232 0.24
233 0.24
234 0.23
235 0.24
236 0.18
237 0.13
238 0.16
239 0.16
240 0.2
241 0.21
242 0.21
243 0.23
244 0.23
245 0.25
246 0.22
247 0.23
248 0.21
249 0.22
250 0.22
251 0.22
252 0.22
253 0.22
254 0.18
255 0.18
256 0.19
257 0.19
258 0.19
259 0.17
260 0.16
261 0.15
262 0.15
263 0.12
264 0.16
265 0.16
266 0.18
267 0.2
268 0.2
269 0.22
270 0.24
271 0.28
272 0.25
273 0.26
274 0.23
275 0.26
276 0.3
277 0.28
278 0.26
279 0.25
280 0.26
281 0.25
282 0.27
283 0.3
284 0.26
285 0.29
286 0.34
287 0.36
288 0.33
289 0.31
290 0.38
291 0.34
292 0.36
293 0.34
294 0.36
295 0.31
296 0.37
297 0.44
298 0.4
299 0.41