Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E7I0

Protein Details
Accession A0A0C4E7I0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-88EPSPPRQRFRPQWARRQPPNRDNSPHydrophilic
NLS Segment(s)
PositionSequence
42-107PTPKKGGRPEPERGRSPSPPPREPSPPRQRFRPQWARRQPPNRDNSPSRTGSPPRTGGTSPRRNGS
Subcellular Location(s) extr 19, E.R. 3, golg 2, mito 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MHVKFLLPFLLAGVLALPTPAEGTIEARDPSYILEARRIGDPTPKKGGRPEPERGRSPSPPPREPSPPRQRFRPQWARRQPPNRDNSPSRTGSPPRTGGTSPRRNGSPPRNTKRDVEAEEAEELQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.07
11 0.09
12 0.12
13 0.12
14 0.12
15 0.12
16 0.12
17 0.12
18 0.14
19 0.15
20 0.13
21 0.17
22 0.18
23 0.19
24 0.21
25 0.22
26 0.18
27 0.25
28 0.29
29 0.29
30 0.37
31 0.37
32 0.36
33 0.42
34 0.5
35 0.5
36 0.51
37 0.56
38 0.56
39 0.61
40 0.64
41 0.62
42 0.59
43 0.53
44 0.55
45 0.54
46 0.51
47 0.5
48 0.5
49 0.49
50 0.53
51 0.55
52 0.58
53 0.6
54 0.63
55 0.62
56 0.66
57 0.7
58 0.68
59 0.74
60 0.75
61 0.71
62 0.72
63 0.79
64 0.81
65 0.82
66 0.84
67 0.83
68 0.81
69 0.82
70 0.77
71 0.74
72 0.7
73 0.67
74 0.64
75 0.57
76 0.51
77 0.5
78 0.49
79 0.48
80 0.49
81 0.46
82 0.41
83 0.42
84 0.4
85 0.42
86 0.48
87 0.51
88 0.48
89 0.49
90 0.5
91 0.5
92 0.58
93 0.59
94 0.6
95 0.61
96 0.68
97 0.7
98 0.71
99 0.72
100 0.71
101 0.69
102 0.63
103 0.59
104 0.52
105 0.48