Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4DJZ2

Protein Details
Accession A0A0C4DJZ2    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-112RTNTREQRRRSRLEREHRGLBasic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045071  BBP-like  
IPR036612  KH_dom_type_1_sf  
IPR032570  SF1-HH  
IPR047086  SF1-HH_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0045131  F:pre-mRNA branch point binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF16275  SF1-HH  
Amino Acid Sequences MSRISSIPSIAHLHEPRRGPRTRWGPYSRIASLANRPLAITGPLTDEQKDAYVLCLRIDEIQHQLQQEAEEVALSSRPRSLSPPPEYDAAGRRTNTREQRRRSRLEREHRGLEETALETVPGYRPPRSYRHWHSRNSTILREKIYIPVADHPSVNFIGQIPGPRGSTSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.46
4 0.51
5 0.54
6 0.49
7 0.54
8 0.61
9 0.63
10 0.67
11 0.66
12 0.62
13 0.63
14 0.66
15 0.56
16 0.49
17 0.44
18 0.38
19 0.38
20 0.41
21 0.37
22 0.3
23 0.29
24 0.26
25 0.25
26 0.23
27 0.16
28 0.1
29 0.13
30 0.14
31 0.16
32 0.16
33 0.15
34 0.14
35 0.14
36 0.14
37 0.1
38 0.1
39 0.13
40 0.13
41 0.13
42 0.12
43 0.12
44 0.13
45 0.14
46 0.13
47 0.14
48 0.16
49 0.18
50 0.18
51 0.17
52 0.16
53 0.15
54 0.14
55 0.1
56 0.07
57 0.05
58 0.05
59 0.05
60 0.07
61 0.06
62 0.06
63 0.07
64 0.08
65 0.09
66 0.13
67 0.18
68 0.24
69 0.29
70 0.32
71 0.32
72 0.32
73 0.32
74 0.3
75 0.3
76 0.25
77 0.24
78 0.21
79 0.22
80 0.24
81 0.31
82 0.39
83 0.46
84 0.5
85 0.56
86 0.67
87 0.73
88 0.77
89 0.76
90 0.78
91 0.77
92 0.79
93 0.81
94 0.75
95 0.73
96 0.65
97 0.62
98 0.52
99 0.42
100 0.32
101 0.23
102 0.18
103 0.12
104 0.11
105 0.07
106 0.08
107 0.09
108 0.12
109 0.14
110 0.16
111 0.2
112 0.25
113 0.31
114 0.36
115 0.45
116 0.5
117 0.58
118 0.64
119 0.68
120 0.7
121 0.72
122 0.75
123 0.7
124 0.69
125 0.65
126 0.61
127 0.57
128 0.52
129 0.46
130 0.41
131 0.39
132 0.33
133 0.27
134 0.31
135 0.33
136 0.32
137 0.31
138 0.26
139 0.27
140 0.26
141 0.24
142 0.17
143 0.13
144 0.14
145 0.15
146 0.19
147 0.18
148 0.21
149 0.22
150 0.22