Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EEY9

Protein Details
Accession A0A0C4EEY9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
63-103AKRPRNTSGICRQRRRRRSPSWSYARKRNGRTKGNRRGSAVHydrophilic
NLS Segment(s)
PositionSequence
74-100RQRRRRRSPSWSYARKRNGRTKGNRRG
Subcellular Location(s) cyto 20.5, cyto_nucl 12.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MLSVLPTSEKVGNVAFSTGETAAILEVVCWTRDGDSLNPSTILLRKKTQGKALLVVGETGEVAKRPRNTSGICRQRRRRRSPSWSYARKRNGRTKGNRRGSAVPIRAVGVTLYEFSDMGLLGSAETEKTAAERLVVVVIAEAVVAGREVKNRSPDAPALAAAQPSCPTGPAPLKVTPTSPTSSETANHGADDINDDSGSESHDENASPQASAPVIRRRGRTGDGGDFAAVTVGYPSDYDPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.12
4 0.14
5 0.12
6 0.11
7 0.09
8 0.09
9 0.08
10 0.08
11 0.07
12 0.05
13 0.07
14 0.08
15 0.08
16 0.08
17 0.09
18 0.1
19 0.12
20 0.15
21 0.15
22 0.19
23 0.21
24 0.22
25 0.21
26 0.21
27 0.21
28 0.23
29 0.25
30 0.24
31 0.26
32 0.32
33 0.4
34 0.44
35 0.49
36 0.52
37 0.49
38 0.49
39 0.48
40 0.43
41 0.35
42 0.31
43 0.24
44 0.16
45 0.13
46 0.09
47 0.07
48 0.06
49 0.08
50 0.12
51 0.16
52 0.19
53 0.23
54 0.28
55 0.3
56 0.38
57 0.47
58 0.53
59 0.58
60 0.66
61 0.73
62 0.79
63 0.86
64 0.88
65 0.87
66 0.87
67 0.88
68 0.88
69 0.88
70 0.88
71 0.88
72 0.84
73 0.84
74 0.83
75 0.81
76 0.79
77 0.78
78 0.77
79 0.76
80 0.81
81 0.82
82 0.83
83 0.85
84 0.8
85 0.75
86 0.69
87 0.65
88 0.62
89 0.54
90 0.44
91 0.35
92 0.32
93 0.27
94 0.23
95 0.17
96 0.09
97 0.07
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.04
125 0.03
126 0.03
127 0.03
128 0.02
129 0.02
130 0.02
131 0.02
132 0.03
133 0.04
134 0.07
135 0.09
136 0.12
137 0.17
138 0.18
139 0.2
140 0.23
141 0.23
142 0.23
143 0.22
144 0.2
145 0.18
146 0.17
147 0.16
148 0.13
149 0.13
150 0.11
151 0.11
152 0.1
153 0.08
154 0.08
155 0.12
156 0.16
157 0.18
158 0.22
159 0.24
160 0.27
161 0.28
162 0.29
163 0.27
164 0.26
165 0.26
166 0.23
167 0.22
168 0.2
169 0.21
170 0.2
171 0.22
172 0.23
173 0.21
174 0.19
175 0.17
176 0.16
177 0.15
178 0.18
179 0.15
180 0.11
181 0.1
182 0.11
183 0.11
184 0.11
185 0.13
186 0.1
187 0.1
188 0.1
189 0.11
190 0.11
191 0.11
192 0.16
193 0.15
194 0.13
195 0.13
196 0.14
197 0.13
198 0.16
199 0.21
200 0.25
201 0.33
202 0.38
203 0.42
204 0.45
205 0.51
206 0.52
207 0.54
208 0.51
209 0.49
210 0.47
211 0.44
212 0.39
213 0.33
214 0.29
215 0.22
216 0.15
217 0.08
218 0.06
219 0.05
220 0.05
221 0.06