Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EEA7

Protein Details
Accession A0A0C4EEA7   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-108MSPSQRKTPKKEPSGRPRGRPRNSGKPRGRPPKGBasic
NLS Segment(s)
PositionSequence
10-14RGRPR
33-46AKKRGRPSGSGATR
54-117KVTKKSTVTSSKTGRPRGRPPMSPSQRKTPKKEPSGRPRGRPRNSGKPRGRPPKGAAAAKGRKS
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MAPTTTGKGRGRPRKSDAGDGASAAAVSSSTPAKKRGRPSGSGATRTPAEADAKVTKKSTVTSSKTGRPRGRPPMSPSQRKTPKKEPSGRPRGRPRNSGKPRGRPPKGAAAAKGRKSGDGVAAAAEDDDEELASGDAEDADGDDDAEAEQDEELDDGAAAVAAPASIAESGWRHLLSPWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.74
4 0.69
5 0.64
6 0.57
7 0.48
8 0.42
9 0.31
10 0.26
11 0.17
12 0.11
13 0.05
14 0.04
15 0.06
16 0.08
17 0.11
18 0.14
19 0.22
20 0.29
21 0.36
22 0.45
23 0.54
24 0.57
25 0.58
26 0.64
27 0.67
28 0.66
29 0.64
30 0.56
31 0.49
32 0.43
33 0.39
34 0.32
35 0.24
36 0.19
37 0.15
38 0.18
39 0.22
40 0.24
41 0.25
42 0.25
43 0.24
44 0.23
45 0.24
46 0.27
47 0.29
48 0.32
49 0.37
50 0.41
51 0.47
52 0.53
53 0.6
54 0.6
55 0.58
56 0.62
57 0.65
58 0.66
59 0.64
60 0.64
61 0.66
62 0.69
63 0.71
64 0.66
65 0.66
66 0.7
67 0.71
68 0.73
69 0.71
70 0.72
71 0.73
72 0.79
73 0.78
74 0.79
75 0.84
76 0.81
77 0.8
78 0.81
79 0.82
80 0.77
81 0.76
82 0.73
83 0.73
84 0.76
85 0.78
86 0.75
87 0.74
88 0.79
89 0.81
90 0.78
91 0.72
92 0.67
93 0.67
94 0.65
95 0.58
96 0.51
97 0.5
98 0.54
99 0.51
100 0.53
101 0.42
102 0.36
103 0.36
104 0.33
105 0.25
106 0.19
107 0.16
108 0.11
109 0.11
110 0.1
111 0.09
112 0.07
113 0.05
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.02
152 0.03
153 0.04
154 0.04
155 0.07
156 0.08
157 0.1
158 0.13
159 0.14
160 0.14