Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EE73

Protein Details
Accession A0A0C4EE73    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-34QQPPECAPKPGKKRRACKDCTCGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007785  Anamorsin  
IPR046408  CIAPIN1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05093  CIAPIN1  
Amino Acid Sequences MTEEDLMRPIQQPPECAPKPGKKRRACKDCTCGLAERLEAKDKARREKADAQLKTLKLASEDLAELDFTVQGKTGSCNSCSLGDAFRCADCPYIGLPPFKPGEEVTILNNVAQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.42
4 0.47
5 0.48
6 0.58
7 0.65
8 0.7
9 0.69
10 0.79
11 0.85
12 0.88
13 0.86
14 0.85
15 0.82
16 0.77
17 0.72
18 0.65
19 0.56
20 0.48
21 0.41
22 0.32
23 0.28
24 0.24
25 0.24
26 0.22
27 0.22
28 0.25
29 0.28
30 0.36
31 0.4
32 0.4
33 0.42
34 0.5
35 0.57
36 0.61
37 0.57
38 0.53
39 0.52
40 0.5
41 0.45
42 0.37
43 0.27
44 0.18
45 0.19
46 0.14
47 0.09
48 0.09
49 0.08
50 0.07
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.07
61 0.12
62 0.14
63 0.14
64 0.16
65 0.17
66 0.18
67 0.19
68 0.18
69 0.17
70 0.16
71 0.17
72 0.17
73 0.15
74 0.16
75 0.15
76 0.16
77 0.12
78 0.13
79 0.12
80 0.17
81 0.2
82 0.22
83 0.22
84 0.25
85 0.27
86 0.26
87 0.27
88 0.21
89 0.23
90 0.23
91 0.24
92 0.21
93 0.25
94 0.25