Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E2B4

Protein Details
Accession A0A0C4E2B4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
135-157CCSTSRSRSRSRRGRTGERRLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 3, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MCPGAAASAAGDPGDWTCGLVLLWDWRCGWADAASVSARGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFPGFYGSQGGGDGSGYDDVCLVITVAAAITADLFCCSTSRSRSRSRRGRTGERRLLLLLMLPVPREHVLGLLAPFALEGGFGLGLGDAVGLLVGRLSFFAPVALAGHAQETGVVTWRTADAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.08
6 0.08
7 0.07
8 0.08
9 0.14
10 0.16
11 0.17
12 0.18
13 0.19
14 0.21
15 0.21
16 0.21
17 0.15
18 0.15
19 0.13
20 0.15
21 0.14
22 0.13
23 0.12
24 0.12
25 0.11
26 0.1
27 0.1
28 0.08
29 0.12
30 0.12
31 0.12
32 0.16
33 0.16
34 0.16
35 0.19
36 0.18
37 0.15
38 0.17
39 0.17
40 0.13
41 0.15
42 0.15
43 0.13
44 0.15
45 0.15
46 0.13
47 0.15
48 0.15
49 0.13
50 0.15
51 0.15
52 0.13
53 0.15
54 0.15
55 0.13
56 0.15
57 0.15
58 0.13
59 0.15
60 0.15
61 0.13
62 0.15
63 0.15
64 0.13
65 0.15
66 0.15
67 0.13
68 0.15
69 0.15
70 0.13
71 0.15
72 0.15
73 0.13
74 0.15
75 0.15
76 0.13
77 0.15
78 0.15
79 0.13
80 0.15
81 0.15
82 0.13
83 0.15
84 0.15
85 0.13
86 0.14
87 0.14
88 0.11
89 0.13
90 0.13
91 0.1
92 0.11
93 0.1
94 0.08
95 0.08
96 0.07
97 0.05
98 0.04
99 0.04
100 0.03
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.06
124 0.09
125 0.15
126 0.22
127 0.27
128 0.37
129 0.47
130 0.57
131 0.66
132 0.7
133 0.74
134 0.76
135 0.82
136 0.82
137 0.84
138 0.82
139 0.73
140 0.67
141 0.57
142 0.49
143 0.38
144 0.29
145 0.19
146 0.12
147 0.12
148 0.1
149 0.1
150 0.12
151 0.12
152 0.12
153 0.11
154 0.09
155 0.09
156 0.1
157 0.11
158 0.09
159 0.08
160 0.07
161 0.07
162 0.06
163 0.05
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.03
171 0.04
172 0.04
173 0.03
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.03
181 0.03
182 0.04
183 0.04
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.07
190 0.08
191 0.08
192 0.08
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.08
199 0.12
200 0.12
201 0.12
202 0.13
203 0.13