Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EGH5

Protein Details
Accession A0A0C4EGH5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
34-55DAYIKQAKPKGRKKGKGKDGGABasic
NLS Segment(s)
PositionSequence
40-51AKPKGRKKGKGK
Subcellular Location(s) cyto 13, cyto_nucl 13, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019240  DUF2196  
Amino Acid Sequences MVRSEGVQGGARRGLVRDTRLDEDDKPAEQIGLDAYIKQAKPKGRKKGKGKDGGASVDPSAASQSTATASCPVCGTFEGDEAAVAHHVAGHFET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.27
5 0.31
6 0.34
7 0.35
8 0.37
9 0.32
10 0.34
11 0.33
12 0.28
13 0.25
14 0.21
15 0.18
16 0.15
17 0.14
18 0.09
19 0.09
20 0.08
21 0.07
22 0.08
23 0.12
24 0.12
25 0.14
26 0.17
27 0.22
28 0.32
29 0.4
30 0.5
31 0.57
32 0.66
33 0.75
34 0.81
35 0.84
36 0.84
37 0.77
38 0.71
39 0.63
40 0.56
41 0.47
42 0.38
43 0.28
44 0.19
45 0.17
46 0.12
47 0.1
48 0.07
49 0.07
50 0.05
51 0.06
52 0.07
53 0.07
54 0.08
55 0.11
56 0.12
57 0.12
58 0.13
59 0.12
60 0.12
61 0.12
62 0.15
63 0.12
64 0.12
65 0.13
66 0.12
67 0.12
68 0.11
69 0.11
70 0.09
71 0.08
72 0.06
73 0.07
74 0.07