Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EDG1

Protein Details
Accession A0A0C4EDG1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-39AGSGKQHAKKISKREQRAQAKTQKAFRSHydrophilic
NLS Segment(s)
PositionSequence
16-29KQHAKKISKREQRA
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MERAAKLQERTAGSGKQHAKKISKREQRAQAKTQKAFRSAVKFTKHGNHSSTQAASSRERYSDTEVGVRKQIPLELFLFLSSRIPEVAFHRLRGTAHLPQLIRAADHACAWASKKESRWIKATMLHGLCNLTDNGEVGPEILRRYLIELTLSYCQGDMDVFARDVEMVRNLRQKVQTLDQLFPELTSSSSPGHGNPQQHDGGAASWTPSPLATQHAATWSIPPAPGILPSNSDPAQSSPLAARCAETLPIRSIPPAPQPQSQPNSWPIEIPNASVSAAPWTVGRISSGVSEDYQRQMTPAASIPAFIPPPHGNTPRASFHPAVNNPAAQDSSTPPHLAPIQPLNGVQQSAATPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.52
4 0.55
5 0.58
6 0.62
7 0.65
8 0.74
9 0.76
10 0.77
11 0.8
12 0.83
13 0.86
14 0.87
15 0.88
16 0.87
17 0.86
18 0.85
19 0.83
20 0.82
21 0.77
22 0.71
23 0.67
24 0.63
25 0.61
26 0.58
27 0.59
28 0.56
29 0.53
30 0.53
31 0.59
32 0.58
33 0.55
34 0.52
35 0.48
36 0.45
37 0.46
38 0.43
39 0.35
40 0.33
41 0.31
42 0.31
43 0.32
44 0.32
45 0.29
46 0.3
47 0.3
48 0.34
49 0.34
50 0.32
51 0.34
52 0.34
53 0.35
54 0.37
55 0.35
56 0.29
57 0.27
58 0.28
59 0.21
60 0.22
61 0.21
62 0.18
63 0.17
64 0.16
65 0.15
66 0.13
67 0.13
68 0.11
69 0.1
70 0.09
71 0.09
72 0.11
73 0.14
74 0.23
75 0.23
76 0.24
77 0.25
78 0.26
79 0.26
80 0.29
81 0.3
82 0.26
83 0.28
84 0.32
85 0.3
86 0.3
87 0.33
88 0.29
89 0.23
90 0.19
91 0.17
92 0.12
93 0.13
94 0.12
95 0.09
96 0.1
97 0.12
98 0.14
99 0.16
100 0.19
101 0.22
102 0.3
103 0.37
104 0.39
105 0.42
106 0.42
107 0.41
108 0.43
109 0.43
110 0.42
111 0.36
112 0.33
113 0.29
114 0.27
115 0.23
116 0.19
117 0.17
118 0.09
119 0.08
120 0.08
121 0.07
122 0.07
123 0.07
124 0.05
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.09
132 0.1
133 0.09
134 0.09
135 0.09
136 0.11
137 0.12
138 0.12
139 0.1
140 0.09
141 0.09
142 0.08
143 0.07
144 0.06
145 0.05
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.09
154 0.09
155 0.12
156 0.18
157 0.18
158 0.22
159 0.23
160 0.25
161 0.24
162 0.27
163 0.3
164 0.27
165 0.27
166 0.24
167 0.24
168 0.22
169 0.18
170 0.15
171 0.1
172 0.08
173 0.07
174 0.08
175 0.07
176 0.09
177 0.09
178 0.09
179 0.14
180 0.18
181 0.2
182 0.2
183 0.24
184 0.23
185 0.22
186 0.22
187 0.17
188 0.14
189 0.11
190 0.1
191 0.07
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.06
198 0.09
199 0.09
200 0.1
201 0.11
202 0.12
203 0.14
204 0.13
205 0.14
206 0.12
207 0.12
208 0.11
209 0.1
210 0.1
211 0.09
212 0.11
213 0.11
214 0.11
215 0.13
216 0.14
217 0.18
218 0.17
219 0.17
220 0.16
221 0.16
222 0.18
223 0.15
224 0.15
225 0.14
226 0.16
227 0.18
228 0.17
229 0.16
230 0.14
231 0.15
232 0.17
233 0.15
234 0.15
235 0.16
236 0.18
237 0.18
238 0.18
239 0.2
240 0.2
241 0.27
242 0.32
243 0.33
244 0.36
245 0.41
246 0.48
247 0.5
248 0.48
249 0.45
250 0.43
251 0.45
252 0.4
253 0.37
254 0.3
255 0.33
256 0.32
257 0.29
258 0.24
259 0.19
260 0.19
261 0.17
262 0.16
263 0.12
264 0.11
265 0.1
266 0.09
267 0.1
268 0.1
269 0.1
270 0.11
271 0.08
272 0.09
273 0.1
274 0.11
275 0.11
276 0.12
277 0.14
278 0.16
279 0.18
280 0.19
281 0.18
282 0.17
283 0.17
284 0.17
285 0.17
286 0.17
287 0.18
288 0.16
289 0.17
290 0.16
291 0.19
292 0.2
293 0.17
294 0.21
295 0.19
296 0.25
297 0.32
298 0.36
299 0.34
300 0.37
301 0.43
302 0.42
303 0.45
304 0.45
305 0.39
306 0.4
307 0.47
308 0.46
309 0.47
310 0.44
311 0.41
312 0.36
313 0.36
314 0.32
315 0.22
316 0.22
317 0.2
318 0.22
319 0.24
320 0.24
321 0.22
322 0.25
323 0.28
324 0.28
325 0.29
326 0.31
327 0.32
328 0.32
329 0.33
330 0.33
331 0.32
332 0.31
333 0.25
334 0.2