Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RAT9

Protein Details
Accession F4RAT9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
112-137NEIEKEKEKEKEKEKEKKKEEKEGIDAcidic
NLS Segment(s)
PositionSequence
117-133EKEKEKEKEKEKKKEEK
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
KEGG mlr:MELLADRAFT_70992  -  
Amino Acid Sequences MCEINKNLIEAWLECLCRSKHFHLAIGLVFDEMKLEEIGILPDQRTVSILLRFCRKESEIRKAKLENRNGSLGRNDVVVDDEDDVFELVRNRIRVELPFVWDQVRFEGLTLNEIEKEKEKEKEKEKEKKKEEKEGID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.24
4 0.27
5 0.32
6 0.32
7 0.37
8 0.39
9 0.42
10 0.39
11 0.4
12 0.36
13 0.31
14 0.26
15 0.18
16 0.15
17 0.12
18 0.1
19 0.07
20 0.07
21 0.06
22 0.05
23 0.05
24 0.06
25 0.07
26 0.08
27 0.08
28 0.07
29 0.09
30 0.09
31 0.09
32 0.09
33 0.1
34 0.11
35 0.15
36 0.18
37 0.18
38 0.25
39 0.26
40 0.26
41 0.27
42 0.27
43 0.31
44 0.35
45 0.43
46 0.45
47 0.47
48 0.5
49 0.51
50 0.58
51 0.56
52 0.58
53 0.52
54 0.46
55 0.49
56 0.45
57 0.42
58 0.35
59 0.28
60 0.2
61 0.16
62 0.13
63 0.08
64 0.09
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.05
73 0.06
74 0.07
75 0.07
76 0.1
77 0.11
78 0.12
79 0.14
80 0.15
81 0.15
82 0.21
83 0.22
84 0.23
85 0.24
86 0.25
87 0.24
88 0.23
89 0.23
90 0.17
91 0.17
92 0.12
93 0.11
94 0.14
95 0.13
96 0.14
97 0.15
98 0.14
99 0.15
100 0.16
101 0.18
102 0.19
103 0.24
104 0.26
105 0.33
106 0.4
107 0.46
108 0.55
109 0.63
110 0.69
111 0.74
112 0.81
113 0.84
114 0.86
115 0.88
116 0.87
117 0.88