Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PPI2

Protein Details
Accession A0A1D8PPI2   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
33-115DDIPLAKKSRKKRVESDYEEDEDEVPLKKRKLSNGRAKKQVKTETKVKKEPKSANKSKSTSKKDTKVKKEKTTVKKESKATSTHydrophilic
633-658HHTIIKRQREQAKKKLERDNEKLKLEBasic
NLS Segment(s)
PositionSequence
40-44KSRKK
60-111KKRKLSNGRAKKQVKTETKVKKEPKSANKSKSTSKKDTKVKKEKTTVKKESK
258-275EEKKAMSREEKKRIKEEK
307-319GRGAHPKTGKLKR
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011010  DNA_brk_join_enz  
IPR013034  DNA_topo_DNA_db_N_dom1  
IPR013030  DNA_topo_DNA_db_N_dom2  
IPR001631  TopoI  
IPR018521  TopoI_AS  
IPR025834  TopoI_C_dom  
IPR014711  TopoI_cat_a-hlx-sub_euk  
IPR014727  TopoI_cat_a/b-sub_euk  
IPR013500  TopoI_cat_euk  
IPR008336  TopoI_DNA-bd_euk  
IPR036202  TopoI_DNA-bd_euk_N_sf  
IPR013499  TopoI_euk  
Gene Ontology GO:0005829  C:cytosol  
GO:0005730  C:nucleolus  
GO:0031298  C:replication fork protection complex  
GO:0003677  F:DNA binding  
GO:0003917  F:DNA topoisomerase type I (single strand cut, ATP-independent) activity  
GO:0007059  P:chromosome segregation  
GO:0006260  P:DNA replication  
GO:0006271  P:DNA strand elongation involved in DNA replication  
GO:0006265  P:DNA topological change  
GO:0030448  P:hyphal growth  
GO:0007076  P:mitotic chromosome condensation  
GO:0007097  P:nuclear migration  
GO:0000183  P:rDNA heterochromatin formation  
GO:0000019  P:regulation of mitotic recombination  
GO:0006357  P:regulation of transcription by RNA polymerase II  
GO:0009303  P:rRNA transcription  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG cal:CAALFM_C600950CA  -  
Pfam View protein in Pfam  
PF14370  Topo_C_assoc  
PF01028  Topoisom_I  
PF02919  Topoisom_I_N  
PROSITE View protein in PROSITE  
PS00176  TOPOISOMERASE_I_EUK  
CDD cd00659  Topo_IB_C  
cd03488  Topoisomer_IB_N_htopoI_like  
Amino Acid Sequences MSSSDEEDIALSRLAKKSSSITSASTYEDDEDDDIPLAKKSRKKRVESDYEEDEDEVPLKKRKLSNGRAKKQVKTETKVKKEPKSANKSKSTSKKDTKVKKEKTTVKKESKATSTKVKEESKTQSDSQASVKSETPEEDQGYKWWEVNQEEEGDGYIKWQTLEHNGVMFPPPYEPLPSHVKLYYNNKPVNLPPEAEEVAGFYGAMLETDHAKNPVFQKNFFNDFLEVLKECGGCGVEIKKFEKLDFSKMYAHFEKLREEKKAMSREEKKRIKEEKEKEEEPYRTCYLNGRKELVGNFRIEPPGLFRGRGAHPKTGKLKRRVVPEQVTLNLGKDAKIPEPPAGHQWGEIRHDNEVTWLAMWKENISDSLKYVRFANNSSVKGQSDFKKFETARKLRDHVDSIRKDYTKMLKSEKMQDRQMATAMYLIDVFALRAGGEKGEDEADTVGCCSLRYEHVTLKPPNKVIFDFLGKDSIRFYQEVEVDKQVFKNLRIFKKSPKQPGDDLFDRINPSLVNRQLQNYMKGLTAKVFRTYNASKTMQDQIDIIENEGTVAEKVAKFNAANRTVAILCNHQRTVSKTHGDSVQRINDKLKEFMWQKIRLKKMILQLEPKLKKKDPKYFEEIDDLIKEDIEHIHHTIIKRQREQAKKKLERDNEKLKLEGKPLLTESDIKDKLDKIDELEKEYQKELKTGKPIVTKNATVEKLKQQIETLENKILNVSIQLKDKEDNSEVSLGTSKMNYIDPRLIVMFSKKFDVPIEKLFTKTLREKFIWAIESADENWRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.27
5 0.31
6 0.34
7 0.32
8 0.31
9 0.34
10 0.35
11 0.36
12 0.31
13 0.27
14 0.24
15 0.22
16 0.2
17 0.18
18 0.16
19 0.14
20 0.14
21 0.14
22 0.13
23 0.16
24 0.19
25 0.24
26 0.31
27 0.4
28 0.51
29 0.59
30 0.66
31 0.73
32 0.79
33 0.84
34 0.85
35 0.82
36 0.78
37 0.71
38 0.64
39 0.55
40 0.45
41 0.34
42 0.27
43 0.24
44 0.21
45 0.25
46 0.26
47 0.32
48 0.36
49 0.46
50 0.55
51 0.62
52 0.69
53 0.74
54 0.81
55 0.85
56 0.86
57 0.83
58 0.81
59 0.81
60 0.79
61 0.75
62 0.77
63 0.77
64 0.8
65 0.83
66 0.83
67 0.82
68 0.82
69 0.85
70 0.85
71 0.86
72 0.86
73 0.86
74 0.86
75 0.82
76 0.83
77 0.83
78 0.81
79 0.81
80 0.81
81 0.81
82 0.82
83 0.87
84 0.88
85 0.89
86 0.89
87 0.89
88 0.89
89 0.9
90 0.91
91 0.91
92 0.9
93 0.9
94 0.88
95 0.84
96 0.81
97 0.8
98 0.76
99 0.7
100 0.7
101 0.65
102 0.64
103 0.66
104 0.65
105 0.59
106 0.59
107 0.63
108 0.59
109 0.58
110 0.52
111 0.51
112 0.47
113 0.46
114 0.42
115 0.39
116 0.35
117 0.32
118 0.34
119 0.29
120 0.28
121 0.29
122 0.28
123 0.27
124 0.28
125 0.27
126 0.25
127 0.26
128 0.29
129 0.27
130 0.24
131 0.22
132 0.24
133 0.24
134 0.26
135 0.26
136 0.23
137 0.22
138 0.21
139 0.19
140 0.15
141 0.13
142 0.11
143 0.1
144 0.09
145 0.09
146 0.1
147 0.11
148 0.16
149 0.2
150 0.2
151 0.2
152 0.19
153 0.2
154 0.21
155 0.2
156 0.15
157 0.12
158 0.13
159 0.12
160 0.15
161 0.14
162 0.16
163 0.24
164 0.25
165 0.27
166 0.27
167 0.29
168 0.33
169 0.41
170 0.46
171 0.47
172 0.48
173 0.46
174 0.47
175 0.48
176 0.47
177 0.41
178 0.32
179 0.26
180 0.28
181 0.28
182 0.25
183 0.21
184 0.17
185 0.15
186 0.13
187 0.1
188 0.05
189 0.05
190 0.05
191 0.05
192 0.04
193 0.04
194 0.08
195 0.09
196 0.11
197 0.11
198 0.12
199 0.15
200 0.21
201 0.29
202 0.29
203 0.3
204 0.36
205 0.41
206 0.46
207 0.44
208 0.4
209 0.32
210 0.3
211 0.29
212 0.25
213 0.18
214 0.14
215 0.15
216 0.12
217 0.11
218 0.11
219 0.1
220 0.08
221 0.1
222 0.13
223 0.13
224 0.17
225 0.19
226 0.22
227 0.23
228 0.23
229 0.29
230 0.28
231 0.33
232 0.32
233 0.34
234 0.36
235 0.36
236 0.42
237 0.36
238 0.36
239 0.33
240 0.32
241 0.36
242 0.37
243 0.4
244 0.37
245 0.37
246 0.4
247 0.43
248 0.49
249 0.47
250 0.5
251 0.55
252 0.61
253 0.7
254 0.72
255 0.69
256 0.71
257 0.75
258 0.75
259 0.75
260 0.75
261 0.74
262 0.75
263 0.72
264 0.67
265 0.66
266 0.61
267 0.52
268 0.49
269 0.41
270 0.34
271 0.33
272 0.35
273 0.36
274 0.4
275 0.41
276 0.38
277 0.36
278 0.38
279 0.41
280 0.39
281 0.33
282 0.27
283 0.25
284 0.24
285 0.24
286 0.21
287 0.19
288 0.16
289 0.2
290 0.19
291 0.18
292 0.16
293 0.2
294 0.24
295 0.33
296 0.32
297 0.33
298 0.34
299 0.41
300 0.5
301 0.55
302 0.6
303 0.6
304 0.65
305 0.63
306 0.7
307 0.69
308 0.68
309 0.63
310 0.59
311 0.54
312 0.46
313 0.43
314 0.34
315 0.29
316 0.23
317 0.18
318 0.14
319 0.13
320 0.14
321 0.13
322 0.15
323 0.16
324 0.17
325 0.18
326 0.19
327 0.2
328 0.21
329 0.2
330 0.19
331 0.2
332 0.2
333 0.22
334 0.24
335 0.21
336 0.19
337 0.19
338 0.18
339 0.17
340 0.15
341 0.11
342 0.08
343 0.08
344 0.08
345 0.09
346 0.09
347 0.08
348 0.08
349 0.08
350 0.1
351 0.11
352 0.11
353 0.11
354 0.17
355 0.17
356 0.17
357 0.19
358 0.2
359 0.19
360 0.21
361 0.26
362 0.26
363 0.27
364 0.28
365 0.28
366 0.25
367 0.26
368 0.28
369 0.27
370 0.27
371 0.28
372 0.27
373 0.34
374 0.34
375 0.38
376 0.45
377 0.43
378 0.44
379 0.47
380 0.49
381 0.43
382 0.46
383 0.44
384 0.4
385 0.45
386 0.4
387 0.39
388 0.42
389 0.39
390 0.37
391 0.37
392 0.38
393 0.34
394 0.35
395 0.36
396 0.35
397 0.38
398 0.47
399 0.51
400 0.48
401 0.46
402 0.46
403 0.43
404 0.39
405 0.37
406 0.27
407 0.19
408 0.15
409 0.13
410 0.09
411 0.07
412 0.06
413 0.05
414 0.05
415 0.05
416 0.03
417 0.03
418 0.03
419 0.04
420 0.04
421 0.04
422 0.04
423 0.04
424 0.05
425 0.06
426 0.06
427 0.05
428 0.06
429 0.06
430 0.06
431 0.06
432 0.05
433 0.05
434 0.05
435 0.05
436 0.06
437 0.08
438 0.11
439 0.14
440 0.18
441 0.23
442 0.31
443 0.35
444 0.39
445 0.4
446 0.39
447 0.4
448 0.38
449 0.33
450 0.28
451 0.26
452 0.24
453 0.22
454 0.2
455 0.23
456 0.21
457 0.21
458 0.19
459 0.19
460 0.17
461 0.16
462 0.16
463 0.15
464 0.18
465 0.21
466 0.22
467 0.23
468 0.23
469 0.23
470 0.22
471 0.22
472 0.21
473 0.19
474 0.25
475 0.3
476 0.36
477 0.42
478 0.44
479 0.5
480 0.58
481 0.65
482 0.67
483 0.66
484 0.63
485 0.61
486 0.64
487 0.63
488 0.55
489 0.5
490 0.41
491 0.37
492 0.34
493 0.29
494 0.24
495 0.16
496 0.16
497 0.2
498 0.22
499 0.22
500 0.21
501 0.24
502 0.3
503 0.32
504 0.32
505 0.27
506 0.25
507 0.24
508 0.24
509 0.22
510 0.19
511 0.21
512 0.2
513 0.22
514 0.22
515 0.21
516 0.27
517 0.29
518 0.3
519 0.32
520 0.33
521 0.29
522 0.32
523 0.39
524 0.32
525 0.3
526 0.26
527 0.2
528 0.24
529 0.23
530 0.2
531 0.13
532 0.12
533 0.12
534 0.12
535 0.11
536 0.05
537 0.05
538 0.07
539 0.08
540 0.09
541 0.09
542 0.12
543 0.12
544 0.17
545 0.25
546 0.25
547 0.25
548 0.25
549 0.27
550 0.25
551 0.27
552 0.23
553 0.21
554 0.23
555 0.28
556 0.28
557 0.26
558 0.28
559 0.31
560 0.35
561 0.35
562 0.36
563 0.32
564 0.35
565 0.4
566 0.4
567 0.41
568 0.41
569 0.42
570 0.4
571 0.4
572 0.41
573 0.4
574 0.39
575 0.37
576 0.31
577 0.32
578 0.31
579 0.37
580 0.42
581 0.45
582 0.5
583 0.56
584 0.61
585 0.56
586 0.58
587 0.56
588 0.56
589 0.57
590 0.55
591 0.53
592 0.54
593 0.61
594 0.64
595 0.65
596 0.64
597 0.6
598 0.64
599 0.67
600 0.71
601 0.68
602 0.68
603 0.69
604 0.67
605 0.64
606 0.61
607 0.52
608 0.44
609 0.38
610 0.32
611 0.24
612 0.2
613 0.17
614 0.12
615 0.12
616 0.12
617 0.14
618 0.13
619 0.15
620 0.18
621 0.19
622 0.26
623 0.32
624 0.38
625 0.41
626 0.49
627 0.56
628 0.64
629 0.72
630 0.74
631 0.78
632 0.79
633 0.83
634 0.84
635 0.85
636 0.84
637 0.83
638 0.84
639 0.81
640 0.74
641 0.68
642 0.62
643 0.57
644 0.51
645 0.48
646 0.38
647 0.34
648 0.33
649 0.32
650 0.3
651 0.29
652 0.28
653 0.33
654 0.32
655 0.3
656 0.31
657 0.31
658 0.33
659 0.34
660 0.31
661 0.26
662 0.33
663 0.34
664 0.37
665 0.43
666 0.43
667 0.41
668 0.43
669 0.43
670 0.35
671 0.39
672 0.37
673 0.36
674 0.4
675 0.42
676 0.46
677 0.5
678 0.52
679 0.55
680 0.57
681 0.53
682 0.5
683 0.54
684 0.51
685 0.46
686 0.49
687 0.49
688 0.51
689 0.51
690 0.47
691 0.4
692 0.42
693 0.45
694 0.45
695 0.41
696 0.4
697 0.38
698 0.36
699 0.35
700 0.3
701 0.24
702 0.22
703 0.22
704 0.19
705 0.25
706 0.27
707 0.29
708 0.31
709 0.33
710 0.35
711 0.33
712 0.32
713 0.28
714 0.29
715 0.27
716 0.26
717 0.27
718 0.21
719 0.2
720 0.18
721 0.15
722 0.14
723 0.19
724 0.19
725 0.22
726 0.26
727 0.25
728 0.28
729 0.28
730 0.27
731 0.25
732 0.3
733 0.3
734 0.27
735 0.31
736 0.28
737 0.29
738 0.33
739 0.38
740 0.35
741 0.39
742 0.45
743 0.42
744 0.44
745 0.46
746 0.44
747 0.44
748 0.48
749 0.47
750 0.47
751 0.47
752 0.49
753 0.5
754 0.54
755 0.49
756 0.41
757 0.36
758 0.3
759 0.31
760 0.29