FuNGI

A0A0C4E6L0

Protein Details

Accession

A0A0C4E6L0

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
1-21	MTNIRRPSPSARRPNASNNSA	Hydrophilic
381-405	MSTIRHLTRTWKHSRRIRARLTEGA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 22, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR004695 SLAC1/Mae1/Ssu1/TehA IPR038665 Voltage-dep_anion_channel_sf
Gene Ontology	GO:0016020 C:membrane GO:0055085 P:transmembrane transport
Pfam	View protein in Pfam PF03595 SLAC1
CDD	cd09299 TDT

Amino Acid Sequences

MTNIRRPSPSARRPNASNNSAPLDPSPPPGQARLRIPHLEVDAETDMSKAESVNFSGSTSDLRRAPSKTSLSGDSGAPDASNPDLIPLSPFRTAIRNFSSQWFLVPQGAGITSIVLFSLEYRFKGLDEISYAVWAFTAVCLALMLLAYGLRLAMFPRHVLRLLGSDPAELTCMSSISIAFTSIVQMISLTLGSSNHSWAIAAVSLWWFNMALALVAVVFIPFSIPHLHTPGVASLMPNTQLPMVAAITLAAGGGMVSNTAHLDGLEGLRAPIIFVSYFSLALAVPLAMAYATMYLIRLVDGSAPAKGKIYQEMIFCGPWGQGSFALQALGQSLLKNSPGLAAYMSGGIVSETMINVLGYSSVFMGFSSWSAGTFWWAFAVMSTIRHLTRTWKHSRRIRARLTEGAAEFVHEETERYSLAVWALVFPWGVYTNAAIRLGKVLASGFF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.81
2	0.8
3	0.76
4	0.7
5	0.64
6	0.6
7	0.54
8	0.49
9	0.4
10	0.35
11	0.3
12	0.31
13	0.29
14	0.28
15	0.3
16	0.35
17	0.39
18	0.41
19	0.48
20	0.49
21	0.53
22	0.52
23	0.51
24	0.5
25	0.46
26	0.41
27	0.33
28	0.31
29	0.26
30	0.23
31	0.22
32	0.17
33	0.15
34	0.13
35	0.13
36	0.08
37	0.09
38	0.1
39	0.11
40	0.14
41	0.14
42	0.14
43	0.14
44	0.15
45	0.17
46	0.17
47	0.21
48	0.21
49	0.24
50	0.29
51	0.3
52	0.35
53	0.38
54	0.41
55	0.4
56	0.42
57	0.41
58	0.4
59	0.39
60	0.35
61	0.28
62	0.24
63	0.2
64	0.16
65	0.12
66	0.1
67	0.09
68	0.1
69	0.08
70	0.09
71	0.09
72	0.09
73	0.12
74	0.13
75	0.16
76	0.16
77	0.17
78	0.17
79	0.23
80	0.25
81	0.29
82	0.32
83	0.32
84	0.33
85	0.36
86	0.38
87	0.31
88	0.32
89	0.27
90	0.23
91	0.2
92	0.18
93	0.15
94	0.12
95	0.12
96	0.1
97	0.09
98	0.08
99	0.06
100	0.06
101	0.05
102	0.05
103	0.04
104	0.05
105	0.1
106	0.1
107	0.11
108	0.13
109	0.13
110	0.13
111	0.15
112	0.15
113	0.11
114	0.12
115	0.14
116	0.12
117	0.13
118	0.12
119	0.1
120	0.1
121	0.08
122	0.06
123	0.04
124	0.05
125	0.04
126	0.03
127	0.04
128	0.03
129	0.03
130	0.03
131	0.03
132	0.03
133	0.03
134	0.03
135	0.03
136	0.03
137	0.03
138	0.03
139	0.04
140	0.06
141	0.07
142	0.09
143	0.11
144	0.13
145	0.14
146	0.14
147	0.14
148	0.15
149	0.15
150	0.16
151	0.15
152	0.13
153	0.13
154	0.12
155	0.12
156	0.09
157	0.09
158	0.06
159	0.06
160	0.06
161	0.06
162	0.06
163	0.06
164	0.06
165	0.06
166	0.06
167	0.06
168	0.06
169	0.07
170	0.07
171	0.05
172	0.05
173	0.05
174	0.05
175	0.05
176	0.04
177	0.04
178	0.04
179	0.05
180	0.06
181	0.07
182	0.06
183	0.06
184	0.06
185	0.06
186	0.07
187	0.05
188	0.05
189	0.05
190	0.05
191	0.05
192	0.05
193	0.05
194	0.04
195	0.04
196	0.04
197	0.04
198	0.03
199	0.03
200	0.03
201	0.03
202	0.03
203	0.03
204	0.02
205	0.02
206	0.02
207	0.02
208	0.02
209	0.04
210	0.06
211	0.07
212	0.08
213	0.1
214	0.11
215	0.11
216	0.12
217	0.11
218	0.11
219	0.1
220	0.09
221	0.08
222	0.08
223	0.09
224	0.08
225	0.08
226	0.06
227	0.06
228	0.06
229	0.06
230	0.06
231	0.05
232	0.05
233	0.04
234	0.04
235	0.04
236	0.04
237	0.02
238	0.02
239	0.02
240	0.02
241	0.02
242	0.02
243	0.02
244	0.02
245	0.03
246	0.03
247	0.03
248	0.03
249	0.04
250	0.04
251	0.05
252	0.05
253	0.05
254	0.05
255	0.05
256	0.05
257	0.05
258	0.04
259	0.05
260	0.04
261	0.05
262	0.07
263	0.07
264	0.07
265	0.07
266	0.08
267	0.07
268	0.07
269	0.06
270	0.04
271	0.03
272	0.03
273	0.03
274	0.02
275	0.03
276	0.03
277	0.03
278	0.03
279	0.03
280	0.04
281	0.04
282	0.04
283	0.04
284	0.04
285	0.04
286	0.05
287	0.07
288	0.07
289	0.09
290	0.1
291	0.1
292	0.12
293	0.14
294	0.14
295	0.16
296	0.19
297	0.2
298	0.2
299	0.23
300	0.23
301	0.21
302	0.2
303	0.17
304	0.13
305	0.11
306	0.11
307	0.09
308	0.08
309	0.1
310	0.1
311	0.1
312	0.1
313	0.09
314	0.08
315	0.08
316	0.09
317	0.08
318	0.07
319	0.08
320	0.09
321	0.1
322	0.1
323	0.09
324	0.1
325	0.1
326	0.1
327	0.09
328	0.09
329	0.09
330	0.09
331	0.09
332	0.06
333	0.06
334	0.05
335	0.05
336	0.04
337	0.04
338	0.04
339	0.04
340	0.05
341	0.05
342	0.05
343	0.05
344	0.05
345	0.04
346	0.05
347	0.05
348	0.05
349	0.05
350	0.05
351	0.06
352	0.06
353	0.06
354	0.09
355	0.08
356	0.08
357	0.09
358	0.09
359	0.12
360	0.12
361	0.12
362	0.1
363	0.1
364	0.1
365	0.09
366	0.12
367	0.1
368	0.11
369	0.13
370	0.15
371	0.15
372	0.17
373	0.18
374	0.24
375	0.32
376	0.39
377	0.48
378	0.54
379	0.64
380	0.71
381	0.81
382	0.83
383	0.84
384	0.85
385	0.84
386	0.82
387	0.8
388	0.75
389	0.71
390	0.6
391	0.53
392	0.43
393	0.34
394	0.28
395	0.21
396	0.18
397	0.12
398	0.12
399	0.1
400	0.12
401	0.11
402	0.11
403	0.11
404	0.11
405	0.11
406	0.12
407	0.11
408	0.11
409	0.11
410	0.12
411	0.11
412	0.1
413	0.11
414	0.11
415	0.11
416	0.11
417	0.12
418	0.14
419	0.18
420	0.21
421	0.19
422	0.18
423	0.21
424	0.21
425	0.19
426	0.17

A0A0C4E6L0

3D AlphaFold-predicted Structure Viewer