Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E4U2

Protein Details
Accession A0A0C4E4U2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-75SGGSGKDNKPKRSKSKKKKKEVKPPPGKGRSGYBasic
NLS Segment(s)
PositionSequence
47-73GKDNKPKRSKSKKKKKEVKPPPGKGRS
Subcellular Location(s) nucl 16.5, mito_nucl 12.666, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSGRQGCVPLLAPEGGEYEYAGYSYEYTGEYAAEGGSGGQGNSGGSGKDNKPKRSKSKKKKKEVKPPPGKGRSGYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.09
5 0.08
6 0.07
7 0.07
8 0.07
9 0.06
10 0.06
11 0.06
12 0.07
13 0.06
14 0.06
15 0.07
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.05
33 0.09
34 0.12
35 0.2
36 0.27
37 0.34
38 0.43
39 0.52
40 0.63
41 0.7
42 0.8
43 0.83
44 0.88
45 0.91
46 0.93
47 0.95
48 0.95
49 0.95
50 0.95
51 0.95
52 0.94
53 0.94
54 0.94
55 0.92
56 0.85