Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DVH1

Protein Details
Accession A0A0C4DVH1   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
11-39GGGLRLKGAKVKKHKKKHKDKSAAADKVABasic
NLS Segment(s)
PositionSequence
14-32LRLKGAKVKKHKKKHKDKS
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAGDDYTAAGGGGLRLKGAKVKKHKKKHKDKSAAADKVAELDKALSPSGDNAVTTATTADDDEAAKALAVGSAGKRESRRTDGEEGDDDDDAPPAQYKTEAQRRFEEAKRKKLLEMAESAAARPELLKTHKERVEQLNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.17
5 0.23
6 0.31
7 0.39
8 0.51
9 0.61
10 0.72
11 0.82
12 0.87
13 0.92
14 0.95
15 0.95
16 0.94
17 0.92
18 0.92
19 0.91
20 0.85
21 0.75
22 0.65
23 0.54
24 0.46
25 0.39
26 0.28
27 0.17
28 0.14
29 0.14
30 0.13
31 0.13
32 0.09
33 0.08
34 0.09
35 0.11
36 0.1
37 0.08
38 0.07
39 0.08
40 0.08
41 0.08
42 0.07
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.04
59 0.06
60 0.06
61 0.09
62 0.1
63 0.13
64 0.16
65 0.2
66 0.23
67 0.26
68 0.3
69 0.29
70 0.3
71 0.28
72 0.26
73 0.23
74 0.2
75 0.15
76 0.11
77 0.1
78 0.08
79 0.07
80 0.06
81 0.05
82 0.06
83 0.06
84 0.08
85 0.16
86 0.26
87 0.3
88 0.32
89 0.36
90 0.42
91 0.47
92 0.51
93 0.54
94 0.52
95 0.58
96 0.62
97 0.59
98 0.54
99 0.53
100 0.51
101 0.43
102 0.39
103 0.32
104 0.29
105 0.28
106 0.27
107 0.24
108 0.2
109 0.16
110 0.13
111 0.11
112 0.12
113 0.16
114 0.22
115 0.27
116 0.36
117 0.41
118 0.43
119 0.48
120 0.52
121 0.57
122 0.53
123 0.51
124 0.5
125 0.46
126 0.45
127 0.41
128 0.32
129 0.25
130 0.24
131 0.24
132 0.23
133 0.25
134 0.3
135 0.34
136 0.36