Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E9Y1

Protein Details
Accession A0A0C4E9Y1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
129-153VSTKPKPAVKPVTKPSKPRSRRDVDHydrophilic
NLS Segment(s)
PositionSequence
69-85KPPPKGAPKGKFLGRRE
109-150GKRPQKPSTLHVPKSKPAPGVSTKPKPAVKPVTKPSKPRSRR
Subcellular Location(s) mito 7, cyto 6.5, extr 4, cyto_nucl 4, plas 3, pero 3
Family & Domain DBs
Amino Acid Sequences MQLSCSLAVEALMAVLLVTQAAAAPMAEAHHARGLEPRGLIRPKPVGSTCSDGWCRPNDSPPMIYAHSKPPPKGAPKGKFLGRREVAGKDAAVVEKRANPLYETGVGGGKRPQKPSTLHVPKSKPAPGVSTKPKPAVKPVTKPSKPRSRRDVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.05
14 0.07
15 0.07
16 0.08
17 0.11
18 0.11
19 0.12
20 0.17
21 0.19
22 0.19
23 0.2
24 0.2
25 0.24
26 0.28
27 0.28
28 0.28
29 0.31
30 0.29
31 0.34
32 0.33
33 0.29
34 0.29
35 0.34
36 0.3
37 0.3
38 0.31
39 0.27
40 0.29
41 0.29
42 0.3
43 0.25
44 0.3
45 0.28
46 0.28
47 0.28
48 0.26
49 0.27
50 0.24
51 0.25
52 0.22
53 0.24
54 0.28
55 0.3
56 0.3
57 0.3
58 0.35
59 0.37
60 0.44
61 0.47
62 0.45
63 0.48
64 0.51
65 0.52
66 0.55
67 0.52
68 0.53
69 0.44
70 0.42
71 0.39
72 0.36
73 0.32
74 0.25
75 0.23
76 0.14
77 0.13
78 0.12
79 0.11
80 0.1
81 0.1
82 0.12
83 0.14
84 0.15
85 0.15
86 0.14
87 0.15
88 0.17
89 0.17
90 0.14
91 0.13
92 0.15
93 0.15
94 0.15
95 0.19
96 0.24
97 0.27
98 0.31
99 0.32
100 0.34
101 0.38
102 0.42
103 0.48
104 0.51
105 0.53
106 0.57
107 0.6
108 0.59
109 0.62
110 0.61
111 0.54
112 0.45
113 0.45
114 0.43
115 0.48
116 0.53
117 0.55
118 0.56
119 0.6
120 0.63
121 0.59
122 0.62
123 0.64
124 0.63
125 0.64
126 0.69
127 0.72
128 0.74
129 0.81
130 0.82
131 0.82
132 0.82
133 0.82
134 0.83