Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4E808

Protein Details
Accession A0A0C4E808    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-69SVNLKVNKKLLKKRRPITFFHydrophilic
NLS Segment(s)
PositionSequence
61-63KKR
Subcellular Location(s) mito 16.5, cyto_mito 9.5, nucl 9
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVKHKYKIYGVKIRFYQKENCLFYIFISKAPFFGPFFLWLFNFKRLKIFSVNLKVNKKLLKKRRPITFFAYKSTLYVTPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.59
3 0.58
4 0.55
5 0.61
6 0.57
7 0.52
8 0.46
9 0.42
10 0.38
11 0.38
12 0.31
13 0.24
14 0.23
15 0.2
16 0.19
17 0.19
18 0.2
19 0.13
20 0.14
21 0.12
22 0.12
23 0.13
24 0.13
25 0.13
26 0.14
27 0.16
28 0.22
29 0.22
30 0.2
31 0.24
32 0.24
33 0.26
34 0.27
35 0.27
36 0.28
37 0.35
38 0.41
39 0.44
40 0.47
41 0.46
42 0.47
43 0.51
44 0.52
45 0.54
46 0.58
47 0.62
48 0.68
49 0.75
50 0.81
51 0.8
52 0.76
53 0.75
54 0.74
55 0.67
56 0.62
57 0.58
58 0.48
59 0.43
60 0.42
61 0.35