Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E4U9

Protein Details
Accession A0A0C4E4U9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-36GINVGVKRDRSRRRNGKRQSSLLLHHydrophilic
NLS Segment(s)
PositionSequence
19-29RDRSRRRNGKR
Subcellular Location(s) mito 10, plas 9, extr 7
Family & Domain DBs
Amino Acid Sequences MMDAMVSRLISGINVGVKRDRSRRRNGKRQSSLLLHRALVRQTQGRRWLGRPGPVQRLPPWPFILFGCLPLARLSLVALPSIPLFRASFSCAAAESLTSVPTMFFGKGSCREDSSTPDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.19
4 0.23
5 0.3
6 0.39
7 0.47
8 0.51
9 0.61
10 0.71
11 0.78
12 0.84
13 0.88
14 0.89
15 0.88
16 0.85
17 0.81
18 0.77
19 0.73
20 0.67
21 0.59
22 0.48
23 0.42
24 0.38
25 0.33
26 0.27
27 0.24
28 0.25
29 0.25
30 0.3
31 0.35
32 0.37
33 0.39
34 0.38
35 0.44
36 0.41
37 0.45
38 0.46
39 0.44
40 0.47
41 0.47
42 0.48
43 0.42
44 0.48
45 0.44
46 0.41
47 0.38
48 0.3
49 0.28
50 0.25
51 0.26
52 0.17
53 0.15
54 0.14
55 0.12
56 0.12
57 0.11
58 0.12
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.1
74 0.12
75 0.13
76 0.14
77 0.14
78 0.13
79 0.13
80 0.12
81 0.11
82 0.1
83 0.09
84 0.09
85 0.08
86 0.08
87 0.07
88 0.08
89 0.1
90 0.08
91 0.08
92 0.09
93 0.15
94 0.23
95 0.26
96 0.28
97 0.29
98 0.32
99 0.34