Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4E2R2

Protein Details
Accession A0A0C4E2R2   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MACPLKRRRARKSGTTSAHFHydrophilic
NLS Segment(s)
PositionSequence
7-12RRRARK
Subcellular Location(s) nucl 13.5, mito_nucl 12.5, mito 10.5
Family & Domain DBs
Amino Acid Sequences MACPLKRRRARKSGTTSAHFVHARRRGADNWKLENPTNATPKKQSYGKCANAHSNARVDGPAVHLNLCRVGTSHHVKKPHVKLTDSEAFTTRDVSQGPRFALACRSVIQACLNKISRNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.72
4 0.62
5 0.61
6 0.53
7 0.44
8 0.43
9 0.42
10 0.41
11 0.4
12 0.42
13 0.4
14 0.47
15 0.53
16 0.51
17 0.5
18 0.51
19 0.52
20 0.49
21 0.48
22 0.43
23 0.41
24 0.43
25 0.38
26 0.36
27 0.37
28 0.39
29 0.4
30 0.41
31 0.38
32 0.38
33 0.46
34 0.51
35 0.52
36 0.52
37 0.52
38 0.52
39 0.51
40 0.45
41 0.37
42 0.29
43 0.25
44 0.22
45 0.17
46 0.12
47 0.13
48 0.13
49 0.11
50 0.11
51 0.11
52 0.11
53 0.13
54 0.12
55 0.09
56 0.07
57 0.08
58 0.14
59 0.21
60 0.28
61 0.31
62 0.35
63 0.37
64 0.47
65 0.53
66 0.55
67 0.52
68 0.47
69 0.45
70 0.48
71 0.54
72 0.46
73 0.4
74 0.34
75 0.31
76 0.3
77 0.3
78 0.23
79 0.16
80 0.16
81 0.19
82 0.22
83 0.24
84 0.25
85 0.25
86 0.25
87 0.25
88 0.28
89 0.26
90 0.23
91 0.21
92 0.24
93 0.21
94 0.23
95 0.27
96 0.28
97 0.28
98 0.34
99 0.36